(data stored in ACNUC7421 zone)

EMBL: CP000270.PE315

CP000270.PE315       Location/Qualifiers
FT   CDS_pept        complement(351686..351946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4147"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4147"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28853"
FT                   /db_xref="GOA:Q145Y6"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Y6"
FT                   /protein_id="ABE28853.1"
FT                   /translation="MTIALNRNTIRRPSLRKRFDGWVRGPTLARDIAIVLAIKFALLMV
FT                   LKYTFFNHPQAENMSLPPEQVAQALLSVPASHPSQGDQHAR"
     atgaccatag ccctcaatcg caataccatc cgccgcccga gcctgcgtaa aaggttcgac        60
     ggctgggtgc gcggtccgac gctggcgcgg gatatcgcca tcgtcctcgc catcaagttc       120
     gcattactga tggtgctcaa gtacaccttc ttcaatcatc ctcaggcgga aaacatgtcg       180
     ctgccgcccg agcaagtcgc gcaggcgctg ctctccgtgc ctgcctcgca tccgtcccaa       240
     ggtgatcaac atgcccgtta g                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page