(data stored in ACNUC7421 zone)

EMBL: CP000270.PE318

CP000270.PE318       Location/Qualifiers
FT   CDS_pept        354198..354581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4144"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4144"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28856"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Y3"
FT                   /protein_id="ABE28856.1"
FT                   /translation="MAAKIIEAIRGLERERFRAMVDGDGQSLDTLLAENVSYVHTNGKR
FT                   ETKRQFIDGIVAGRRRYRQIEVQSQDVLPVGRETCVVTGRALIEMEANNGALLFPIAYT
FT                   AIHTQADGQWRLIAWQATRCAIE"
     atggcggcaa agataatcga agcgattcgc gggctcgagc gagagcgttt ccgggcgatg        60
     gtcgacggcg acggccaatc gctcgacacg ctgctcgcgg agaacgtgag ctacgttcac       120
     acgaacggca agcgggaaac gaagcggcag ttcatcgacg ggattgttgc ggggcgccgc       180
     cgctaccggc agatcgaggt gcagtcgcag gacgtgctgc cggttgggcg ggagacctgc       240
     gtggtcaccg gccgggcgct gatcgaaatg gaagcgaata acggagcgct gctgtttccg       300
     atcgcctaca cggcgatcca tacgcaggca gatgggcaat ggcgtctgat tgcctggcag       360
     gccacgcgtt gcgcaatcga gtga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page