(data stored in ACNUC7421 zone)

EMBL: CP000270.PE32

CP000270.PE32        Location/Qualifiers
FT   CDS_pept        40056..41948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4431"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4431"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28570"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:Q147B9"
FT                   /protein_id="ABE28570.1"
FT                   /translation="MDPRLLEYYNQELIYLRESAGEFAQAHPKIARRLGLQAGEMTDPY
FT                   VERLIESFCFMAARMRLKIDAEFPRFTQRLLEVTYPNYVAPTPSMAVAQFYPAHTKGDL
FT                   TGGFRVPRGGKLKTTTPRGEHTPCTFRTTQDVVLYPLEIVSARLTGIPPDIPGIERYVP
FT                   AHSQVCGALRLRIRTTNHEKIASLRNLDRLPVYLAGDEQVASNLFELVHTAGIASIVGE
FT                   PNGFNAPDRPFSAVTSKAVVHEGLDPDQGMLPLIWSKFHGHNLLHEYFACPSRFYFFTL
FT                   TGLQDGLGKTRGAEAEIVVLLDRAPDRLASLVDASRFALFCTPVINLFPQRLERIELAE
FT                   ASTEFHLVPKRQAPLDYEVFSVQALHAQVGNSSEKFEFRPLYQTLNNDEGNHGRYFSVR
FT                   RERRLPSDTSRRYGTRTPYIGTETFVSLVDQREAPYHEGIRYLSADAWLTNRDLPLLVP
FT                   RNGIDDFMQMESGEPIASIGLIRPPSAPRPPYAEGETAWRLIRLLNFNYLPLEDVDHRP
FT                   GGQGLRDMLRLFLSSEDTEHERQVESLLGVKTRSVTRKLPGNGPLVFGRGIECQLTVDE
FT                   TGFSGTSPYLLGLILEHYLARHVSINSFTQTELHSMQRGRITRWPVRMGTRGVA"
     atggatccgc gactactcga atactacaac caggaattga tctacctgcg cgagagcgcg        60
     ggcgagttcg ctcaggcgca cccgaagatc gcgcggcgcc tgggccttca ggcgggtgag       120
     atgaccgacc cctacgtcga gcgtctgatc gagtcgttct gctttatggc cgcgcgcatg       180
     cgactcaaga tcgacgctga gtttccgcgc ttcacgcaac gcctgctcga agtcacttac       240
     ccgaactacg ttgcgcccac gccgtcgatg gcagtggcgc agttctatcc ggctcacacg       300
     aaaggcgatc tgaccggggg cttccgtgtg ccgcgcggcg ggaagctcaa gacaaccacg       360
     ccccgtggcg agcatacgcc ttgcacgttt cgtacaacgc aggatgtcgt gctatatccg       420
     ctggaaatcg tgagtgcgcg gttgacgggc attcctcccg acattcctgg aatcgagcgc       480
     tatgtccccg cgcattcgca agtgtgcggt gcgctgcggc tacgcattcg aaccacgaat       540
     cacgaaaaga ttgcctcgct ccggaatctg gatcgtctgc cggtctatct ggcgggcgat       600
     gagcaggttg cgtcgaacct gttcgagctc gtgcatacgg cgggcatcgc gtcgatcgtc       660
     ggcgagccca acgggttcaa cgcgccagac cgtccctttt cggcagtgac gtcgaaggcc       720
     gtggtgcacg aaggcctcga tcccgatcaa ggcatgctgc cgctcatatg gtccaagttt       780
     cacggacaca atctgctgca tgagtatttc gcgtgcccga gccgcttcta cttcttcacg       840
     cttaccggtc ttcaggatgg cctgggaaaa acccgcggcg cagaagccga gatcgtagtg       900
     ctgctcgacc gtgcgccgga tcggctcgcg agcctcgtcg atgcgtcacg cttcgcgctc       960
     ttctgcacgc cggtcatcaa cctgttcccg caaaggctgg aacgtatcga actggcggag      1020
     gcgagcacgg agtttcatct ggtgcccaaa cgccaggcgc cactcgacta tgaagtgttc      1080
     tcggttcagg cgctgcacgc ccaggtggga aatagctcgg aaaagttcga attccggccg      1140
     ctgtatcaga cgctgaacaa cgacgaaggc aaccacggcc gatacttctc cgtacgccgc      1200
     gagcgccgtt tgccttcgga tacatcgcgc cgctatggca cgcgtacgcc ctatatcggc      1260
     acggagacgt tcgtctcgct cgtcgatcaa cgggaggcac cttatcacga aggaattcgc      1320
     tatctgtccg cggatgcgtg gctgaccaac cgggacctgc ctctgcttgt gccgcgcaac      1380
     ggcatcgacg atttcatgca gatggaaagc ggcgaaccga ttgcgagcat cggcctgatt      1440
     cgcccgccga gcgcgccgcg gccaccttat gcggaaggcg agaccgcatg gcggttgatc      1500
     cggctgttga acttcaacta tttgccgctt gaggacgtcg atcatcggcc gggcggccag      1560
     ggtctgcgcg acatgctacg gctctttctg agcagcgaag acacggagca cgagcgtcag      1620
     gtcgagagcc tgctgggcgt gaagacccgt tccgtgacac gcaagcttcc gggcaatggt      1680
     ccgctcgtgt tcggacgcgg cattgaatgc cagttgaccg tcgatgagac ggggttctcg      1740
     ggaacgagtc cctacctgct ggggctgatt ctcgaacatt atctggcgcg gcacgtatcg      1800
     atcaattcgt tcacgcagac cgaactgcat tcgatgcagc gcggccgcat cacgcgctgg      1860
     cccgtgcgca tgggtacgcg aggagtggcg taa                                   1893
//

If you have problems or comments...

PBIL Back to PBIL home page