(data stored in ACNUC7421 zone)

EMBL: CP000270.PE323

CP000270.PE323       Location/Qualifiers
FT   CDS_pept        358883..359497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4139"
FT                   /product="Conserved hypothetical protein 95"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4139"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28861"
FT                   /db_xref="GOA:Q145X8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q145X8"
FT                   /protein_id="ABE28861.1"
FT                   /translation="MPRSAPSRAQGASSKGGKPHAIRIIGGDWKRTPLPVLDLDGLRPT
FT                   PDRVRETLFNWLGQNLEGQRCLDLFAGSGALGFEAASRGAARVLMVERNARAAGQLRAN
FT                   QERLSARTIEIAEADGLRLAASLAPGSFDVVFLDPPFGTDLLGKALALAAPLVSANGFL
FT                   YVEAGEALELEGNETLAGWEIVRQGKAGAVHFHLLQRENKE"
     atgccccgtt ccgcaccttc gcgcgcccaa ggcgcttcat ccaaaggcgg caagccgcac        60
     gccatccgta tcataggcgg cgactggaaa cgcacgccgc tgcccgtgct cgatctcgac       120
     ggcttgcgcc ccacgcccga tcgcgtgcgc gagacgctat tcaactggct cggccagaat       180
     ctggagggcc agcgctgtct cgatctgttc gccggcagcg gcgcgctcgg cttcgaggcg       240
     gcgtcgcgcg gcgcggcccg ggtattgatg gtggagcgca atgcgcgggc cgccggccag       300
     ttgcgcgcca accaggaacg cctgtcggcg cgcacgatcg aaatcgctga agccgacggt       360
     ttgcgccttg ccgcgagtct cgcgcccgga tcgttcgacg tggtgtttct cgacccgccg       420
     ttcggcacgg atctgctcgg caaagccctt gcgctggcgg cgccgctagt gagcgctaac       480
     ggatttctgt atgtggaagc gggagaggcg ctcgaactcg agggtaacga gacgctcgcc       540
     ggctgggaaa tcgtgcggca aggtaaagcg ggcgctgtcc actttcattt gctgcagcgc       600
     gaaaataagg aataa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page