(data stored in ACNUC7421 zone)

EMBL: CP000270.PE330

CP000270.PE330       Location/Qualifiers
FT   CDS_pept        complement(364346..365227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4132"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4132"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28868"
FT                   /db_xref="GOA:Q145X1"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145X1"
FT                   /protein_id="ABE28868.1"
FT                   /translation="MIETTDSLRDCLAPAKLNLFLHITGRRPDGYHTLQTVFQLLDWGD
FT                   TLHFTRRDDGLITRRTEIADVPPEHDLTVRAATLLKTHTGSPEGVDIEIDKRLPMGAGL
FT                   GGGSSNAATTLLALNRLWKLNLPRLELQALALKLGADVPFFVFGKNAFAQGVGEALDVV
FT                   QLPPRHFLVVTPRVHVPTAAIFSEKALTRDSKPLTITDFPAELSCNTEWPESFGRNDMQ
FT                   QVVVGKYAEVAQVLRWFENVAPARMSGSGASVFAAFRSKAEAEAVQAKLPAEWNSAVAA
FT                   SLDQHPLFTFAS"
     atgattgaaa cgaccgattc gctgcgcgat tgcctcgcgc cagcgaaact caacctcttc        60
     ctgcacatca ccggccgccg gccggatggc tatcacacgc tgcaaacggt gttccagttg       120
     ctcgattggg gcgacacgct gcacttcacg cgacgcgacg acgggctcat cacgcgccgc       180
     accgaaatcg ccgacgtgcc gccggaacac gatctgaccg tgcgcgccgc gacgctgctc       240
     aaaacgcata cgggctcgcc cgaaggcgtc gatatcgaaa tcgacaaacg cctgccgatg       300
     ggcgccggcc tcggcggcgg cagctccaac gcagcgacga cactgctcgc gctcaaccgt       360
     ctgtggaagc tcaacctgcc gcgcctcgaa ttgcaggcgc tggcgttgaa actcggtgcg       420
     gatgtaccgt tttttgtgtt tggaaaaaat gcgttcgctc agggtgtcgg agaggcttta       480
     gacgttgtac aattgccgcc gcgccatttc ctggtagtga cgccgagggt tcatgttccg       540
     actgcagcga ttttctccga aaaagcgttg acaagagatt caaaacccct cacaattacg       600
     gactttcctg cagaacttag ctgcaacact gaatggccag aaagttttgg ccggaacgac       660
     atgcagcagg ttgtcgtagg aaagtacgcg gaagtagcgc aagtgctgcg atggtttgaa       720
     aacgtcgcgc cagcgcggat gtctggatca ggtgcaagtg tctttgcagc gttccgtagt       780
     aaagctgaag cagaagcggt gcaagccaaa ctgccagccg aatggaacag cgcagtggcc       840
     gcaagtctcg atcagcatcc actctttact ttcgcgtcat aa                          882
//

If you have problems or comments...

PBIL Back to PBIL home page