(data stored in ACNUC7421 zone)

EMBL: CP000270.PE332

CP000270.PE332       Location/Qualifiers
FT   CDS_pept        complement(365953..367794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4130"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4130"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28870"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q145W9"
FT                   /protein_id="ABE28870.1"
FT                   /translation="MNLSFVKLFLKRPASAFRVPHAVSARRMLGAAALAVWALAAVPAH
FT                   AQDSSPDSDDTSVTLPDPLGPASAEDQKSLPGVPLTSQIVFQVLAAEVALQRDQPAPAY
FT                   QTYLALARDTHDPRMAQRATEIALAAQSPSDALAAAQLWQQYAPNSERAAQLDASLLVL
FT                   SGRPDDAEPILARELARVPADNRGSAILALQLLLSRGPNRIGGLHVLQDLLKNDLNRPE
FT                   AQLALARQQLVSDDAPGARKSLEQALALKPDYLPAALMLSQMGPEERKEGIASLEKYVQ
FT                   QNPKSHDARLALAQMYLASDRLDDAQKQFEIMHRNNANDLTPLMALALIKIQQKNFNEA
FT                   QTYLTQYAQQAEKTPGADPGQAYIYLAQLSLEQKNDAAASDWLNKISPSSQQYVPAQIT
FT                   RAQLLAKQGKADDARKLLANLPAPDPRDQALIARTDAAILFDARRYPEAETRLQQATAQ
FT                   FPDDPDLTYDYAMSAEKTGHYDVMETQLRKLIQTQPDNPQAYNALGYSLADRNQRLAEA
FT                   DKLVEKASSLAPNDAFIMDSVGWVKYRMGDTSDAIKLLRKAYDMQPNAEIGAHLGEVLW
FT                   KTGNQDQARAAFRDARKLEPDNDTLVKTLQRLQVNDL"
     atgaacttgt ccttcgtgaa gctgtttttg aagcgcccgg ctagcgcatt ccgcgtaccg        60
     cacgccgtgt ccgctcgccg gatgctcggc gcggcggcgc tcgccgtctg ggcgctggct       120
     gccgtgcccg cgcacgcgca ggattcatcg ccggactcgg acgacacctc ggtcaccctc       180
     cccgacccgc tcgggccggc ctcggcggaa gaccagaagt ccctgcccgg ggtgccgctg       240
     acgagccaga tcgtattcca ggtgctcgcc gccgaagtcg cgctgcagcg cgaccagccg       300
     gcgcccgcct atcagaccta cctcgccctt gcgcgcgaca cgcacgatcc tcgcatggcg       360
     caacgcgcca ccgaaatcgc gctggccgcg cagagcccgt ccgacgcatt ggccgccgcg       420
     caattgtggc agcagtatgc gccgaactcg gaacgcgccg cgcaactcga cgcgtcgctg       480
     ctcgtgctgt ccggccgccc tgacgacgcg gagccgatcc tcgcccgcga actcgcgcgg       540
     gtgcccgcgg acaatcgcgg cagcgcgatt ctggcgctgc agctgctgct ctcgcgcggc       600
     ccgaaccgga tcggcggcct gcacgtgctg caggacctgc tcaagaacga cctgaaccgg       660
     ccggaagcgc aactggcact tgcacgacag cagctcgtat cggacgacgc gccgggtgcg       720
     cgcaagtcgc tcgagcaggc gctcgcgctc aagcccgact atttgccggc cgcgctgatg       780
     ctgtcgcaaa tgggcccgga agagcgcaag gaaggcatcg cctcgctcga aaagtacgtg       840
     cagcagaatc cgaaatcgca tgacgcccgt ctcgcgctcg cccagatgta tcttgcgagc       900
     gaccgtctgg acgacgcgca gaagcagttc gagatcatgc acaggaacaa cgcgaacgat       960
     ctcacgccgc tcatggcgct cgcgctgatc aagatccagc agaagaattt caatgaagcg      1020
     caaacgtacc tgacccagta cgcgcagcaa gccgaaaaaa cgccgggcgc ggatcccggc      1080
     caggcgtata tctaccttgc acaactgtcg ctcgaacaga agaacgacgc ggccgcgagc      1140
     gactggctga acaaaatctc gccgtcgagc cagcaatatg tgcccgcgca gatcacgcgc      1200
     gcacaattgc tcgccaagca gggcaaggcc gacgacgcgc gcaagctgct cgccaatctg      1260
     ccggcgccgg acccgcgcga ccaggcgctg atcgcgcgca cggacgcggc gatcctgttc      1320
     gatgcgaggc gttaccccga ggccgaaacg cgcctgcagc aagccacggc gcagttcccc      1380
     gacgaccccg atctgaccta cgactacgcg atgtccgccg aaaagaccgg ccattacgac      1440
     gtcatggaaa cgcagttgcg caagctgatc cagacgcagc ccgacaatcc gcaagcgtat      1500
     aacgcgctcg gctactcgct ggccgatcgc aatcagcgcc tcgccgaggc ggacaagctg      1560
     gtcgagaagg cctcctcgtt ggcgccgaac gacgcattca tcatggacag cgtcggctgg      1620
     gtcaaatacc ggatgggcga cacgtcggac gcgatcaagc tgctgcgcaa agcctacgac      1680
     atgcagccga atgctgaaat cggcgcgcac ctcggcgaag tgttgtggaa aacgggcaat      1740
     caggatcagg cccgcgccgc tttccgcgac gcgcgcaagc tcgaaccgga caacgacacg      1800
     ctggtcaaaa cgctccaacg tcttcaggtg aacgatcttt ga                         1842
//

If you have problems or comments...

PBIL Back to PBIL home page