(data stored in ACNUC7421 zone)

EMBL: CP000270.PE335

CP000270.PE335       Location/Qualifiers
FT   CDS_pept        complement(369878..370510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4127"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4127"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28873"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q145W6"
FT                   /protein_id="ABE28873.1"
FT                   /translation="MSSSTVLADVPLFPLHTVLFPDGLLPLKIFEARYLDMARDCLREK
FT                   TPFGVCLLKSGAEVAREEEPSVPESIGCLAEIEECDVEAFGMLLIRARGTRRFRLLSHR
FT                   VESSGLLVGMAEPLGEDRPLEGNEQLARFGACAEVLERIIATIRERDPESLPFAEPFRL
FT                   DDPSWVSNRLAEVLPIALRARQKLMELQDAGARIDVVHHYMQQHQLL"
     atgtcttctt ctactgtgct tgccgatgtg ccgctgtttc cgttgcatac ggtgctgttt        60
     cccgacggcc ttttgccgct gaagatcttc gaagcgcgct acctcgatat ggcgcgcgac       120
     tgtctgcgtg aaaaaacgcc gtttggcgtg tgtctgctga aaagcggcgc ggaagtggcg       180
     cgcgaagaag agccttcggt gcccgaatca attggctgcc tcgccgaaat cgaggagtgc       240
     gatgtcgaag ccttcggcat gctgctgatt cgcgcacgcg gcacgcggcg ttttcgcctg       300
     ctgtcgcatc gggtggagtc gagcggcttg ctggtcggca tggcggagcc gctcggcgaa       360
     gacaggccgc tcgaaggcaa cgagcagttg gccagattcg gcgcatgcgc ggaagtgctc       420
     gaacggatca tcgcaacgat ccgcgaacgc gatccggaaa gcctgccgtt tgcagagccg       480
     ttccggctcg acgatccgtc gtgggtgtcg aaccgtctcg ccgaagtgct gccgattgcg       540
     ctgcgtgctc gccagaaact gatggagttg caggacgccg gcgcgcggat cgatgtggtt       600
     caccactaca tgcagcaaca tcaattgctc tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page