(data stored in ACNUC7421 zone)

EMBL: CP000270.PE336

CP000270.PE336       Location/Qualifiers
FT   CDS_pept        complement(370550..371488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4126"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4126"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28874"
FT                   /db_xref="GOA:Q145W5"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145W5"
FT                   /protein_id="ABE28874.1"
FT                   /translation="MGTRCYDEIYGFDDSMRIILITGISGSGKSVALNALEDAGYYCVD
FT                   NLPPRFLPQLASYLAEDGQDRLAVAIDARSSASLDEMPAMIRDLSRAHDVRVLFLNAST
FT                   QSLIQRFSETRRRHPLSGSTSHDADVGLLNSLAEAIERERELVAGLAEFGHQIDTSNLR
FT                   ANVLRAWVKRFIEQKDSGLVLMFESFGFKRGVPLDADFVFDVRTLPNPYYDHELRPLTG
FT                   LDKPVIDFLDALPVVHEMIDDIEKFLAKWLPHFRDDNRSYLTVAIGCTGGQHRSVFIAE
FT                   TLAARLAASANVIVRHRDAPVEAGESSKLVA"
     atggggacca gatgctatga tgaaatctac ggtttcgacg actccatgcg cataatcctg        60
     atcaccggta tatccggctc cggcaaatca gttgccctga acgcgcttga agacgcaggc       120
     tactactgcg tcgacaacct gccgccgcgt ttcctgccgc agctggcttc ctatctcgcc       180
     gaagacgggc aagatcgcct tgcggtcgca atcgacgcgc gctcgagcgc ttcgctcgac       240
     gaaatgcccg ccatgattcg cgacctgtcg cgtgcccacg acgtgcgggt gctgttcctg       300
     aacgcgagca cacagtcgct gattcaacgc ttttccgaaa cacgccgccg ccatccgctg       360
     tccggttcaa cctcgcacga cgcggatgtc ggcctgctca actcgcttgc cgaggcgatc       420
     gaacgcgaac gcgaactcgt ggcggggctg gccgaattcg gccatcagat cgacaccagc       480
     aatctgcgcg cgaacgtgct gcgcgcctgg gtcaaacgct tcatcgagca gaaggattcc       540
     gggctcgtgc tgatgttcga gtcgttcggc ttcaagcgtg gcgtgccgct cgacgcggat       600
     ttcgtgttcg acgtgcgcac cttgccgaac ccgtactacg atcatgaatt gcggccgctc       660
     acgggcctcg acaaaccggt gatcgatttt ctggatgcgc tgccggtggt gcatgaaatg       720
     atcgacgaca tcgagaaatt tctcgccaag tggcttccgc atttccgcga cgacaatcgc       780
     agctatctca ccgtcgcgat cggttgcacg ggcggccagc accgctcggt gttcattgcg       840
     gagacgctcg ccgcgcgtct cgcggcatcg gcgaatgtca ttgtgcggca ccgcgatgcg       900
     ccggtcgaag ccggcgaatc atcgaagtta gtggcttaa                              939
//

If you have problems or comments...

PBIL Back to PBIL home page