(data stored in ACNUC7421 zone)

EMBL: CP000270.PE340

CP000270.PE340       Location/Qualifiers
FT   CDS_pept        complement(374061..375578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4122"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN/SigL"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4122"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28878"
FT                   /db_xref="GOA:Q145W1"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q145W1"
FT                   /protein_id="ABE28878.1"
FT                   /translation="MKASLQLRLSQHLALTPQLQQSIRLLQLSTLELQQEVAMAISQNP
FT                   LLENEDDWIASPLRVAADGSLIAQAPNSSAPPDQMGGSTSSSSTSSSERAENGEPQGVD
FT                   EYNGLAGDSNGDASQWNLDDYGRSGNASDDDDLPPLQIHESSTSLRDHLMAQLRVTQAS
FT                   PRDRALVTFLIESLDDDGYLAATLEEVLADLPEELEVDLDELNAALALLHSFDPAGVGA
FT                   RSASECLKLQLLRLDASPTRTLALEIVAHHLELLAARDFTRLRKHLKASDDDLRDAHVL
FT                   IRSLEPFPGAAYGKAEADYVVPDIMVRKTAQGWQAELNPEVVPKLRINHLYANILRNNR
FT                   GDPGSGSLRQQLQEARWLIKNIQQRFETILRVAQAIVERQKSFFVHGEIAMRPLVLREI
FT                   ADTLGLHESTVSRVTTGKYMLTPFGTLEFKYFFGSHVSTDTGGAASSTAIRALIKQLIG
FT                   AENPKSPLSDSRIAELLAEQGFVVARRTVAKYREALKIPAVNLRKSL"
     atgaaagcca gcctccaact ccgcctatcg cagcatcttg cgctgacgcc gcaactgcag        60
     cagtccatcc ggctgcttca gttgtccacg ctcgaattgc agcaggaagt cgcaatggcg       120
     atctcgcaga atccgctcct cgagaacgag gacgactgga tcgcgagccc gctgcgcgtg       180
     gcggccgacg gctcgctgat cgcccaggcg ccgaattcct ccgctccgcc cgaccagatg       240
     ggcggcagca cgtcgtcatc gtccaccagc agcagcgagc gcgccgagaa cggcgagccg       300
     cagggcgtgg acgaatacaa cggcctcgcg ggcgacagta acggcgacgc gtcgcaatgg       360
     aatctcgacg actacggccg ctcgggcaac gcctcggacg acgacgacct gccgccgctg       420
     caaatccacg aatcgagcac ctcgctgcgc gatcacctga tggcgcaatt gcgcgtcacc       480
     caggcgagtc cgcgcgaccg cgcgctggtc acgttcctga tcgagtcgct cgacgacgac       540
     ggctaccttg ccgccacgct cgaagaagtg ctggcggatc tgcccgaaga gctcgaagtc       600
     gacctcgacg agctgaatgc cgcgcttgcg ctgctgcata gcttcgaccc ggccggggtc       660
     ggcgcgcgct ccgcgtcgga atgtctcaag ctgcaattgc tgcgactcga tgcctcacct       720
     acccgcacgc ttgcgctcga aatcgtagcg caccacctgg aattgctcgc ggcgcgcgac       780
     ttcacgcgcc tgcgcaaaca tctgaaagcc agcgacgacg acctgcgcga tgcacacgtg       840
     ctgatccgct cgctcgaacc gttccccggc gccgcctacg gcaaggccga agcggactat       900
     gtcgtgccgg acatcatggt gcgtaaaaca gcacagggct ggcaggccga gctgaacccg       960
     gaagtcgtgc ccaagctgcg tatcaaccat ctttacgcga atatcctgcg caataaccgg      1020
     ggcgatccgg gcagcggttc gttgcgccag caactgcagg aagcgcgctg gctgatcaaa      1080
     aatatccagc agcgtttcga gacgatcctc cgggtggcgc aagccattgt ggagcgtcaa      1140
     aagagctttt ttgtgcatgg cgaaattgcc atgcgcccct tggttttgcg ggaaattgct      1200
     gatacgctgg gcctacacga gtcaactgtc tcgcgtgtga caaccggcaa atacatgctg      1260
     accccattcg ggacgcttga atttaagtac ttcttcggat cacacgtttc gactgacacg      1320
     ggcggcgcgg cgtcttcaac ggcgatccgt gcgctcatca agcaactgat aggagcggaa      1380
     aacccgaaat ctcctctttc agacagccgc atagccgaac tgctggcgga acagggcttc      1440
     gtggtcgcac ggcgtaccgt cgcgaaatat cgtgaagcgc tcaagattcc ggcagtcaac      1500
     ctgcgcaagt cgttatag                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page