(data stored in ACNUC7421 zone)

EMBL: CP000270.PE351

CP000270.PE351       Location/Qualifiers
FT   CDS_pept        complement(384870..386096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4111"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4111"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28889"
FT                   /db_xref="GOA:Q145V0"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q145V0"
FT                   /protein_id="ABE28889.1"
FT                   /translation="MRRQLVRLHRWFGVATALFLFVAGLTGAVIAWDHELDAALNPSFF
FT                   KARTAGTALSGLELARRVEAADPRLQVTYLPLAAEPGHTLQMMVLPRTDPATRQPYPLD
FT                   FNQIAVDPATGEIQGRREWGAVSLARLNLIPFIYKLHYTLQLPFTGGVDIGTWLMGIVG
FT                   IVWLFDSVIALWLSFPSVKVWRKSFAFRFGRGGYALTFDLHRSGGVWIWGLLLIVALTS
FT                   ISMNLSAPVVRPIVSLFSPLTPDPVNNPEIRRAPQPGDTVLSRERIVQLAEQAGKARNL
FT                   GVAPGGIYYAEFMHAYGVGFYATGNDHGDIGLGNPWMYWDAATGRQLAAQIPGKGTAGD
FT                   IFLQVQFPLHSGRILGLGGRILISAVGVAVAVLSATGLLIWLKKLNARRRSAQNASAAR
FT                   DAGRSAARP"
     atgaggcggc agctcgtccg cctgcatcgc tggttcggtg ttgccacagc gctatttctg        60
     ttcgtcgccg gcctcaccgg cgcggtcatc gcgtgggacc atgagctcga tgcggcgctg       120
     aacccgtcgt tcttcaaggc gcgcaccgcc ggcacagcgc tgtcggggct ggaactggcg       180
     cgccgcgtgg aagccgccga tccgcgtctg caggtgacct atctgccgct cgcggccgaa       240
     ccgggccaca cgctgcaaat gatggtgctg ccgcgtaccg acccggccac gcggcagccc       300
     tatccgctcg acttcaatca gatcgccgtc gaccccgcta ccggcgaaat ccaggggcgc       360
     cgcgagtggg gcgccgtttc gctcgcgcgg ctcaatctga tcccgttcat ctacaagctc       420
     cactacacgc tgcagctgcc gttcacgggc ggcgtcgata tcggtacatg gctgatgggg       480
     atcgtcggca tcgtctggct gttcgacagc gtgatcgcgc tgtggctgtc gtttccgagc       540
     gtcaaggtgt ggcgcaagtc gttcgcgttc cgcttcgggc gcggcggcta tgcgctcact       600
     ttcgacctgc accgctccgg cggtgtgtgg atctggggcc tgctgctgat cgttgcgctg       660
     acatcgatat cgatgaatct ttcagcgccg gtggtgcgcc ccatcgtgtc gctgttctcg       720
     ccgctcacgc ccgatccggt caacaatcct gaaatccgcc gcgccccgca gcccggcgac       780
     acggtgctga gccgcgagcg catcgtgcaa ttggccgagc aggccggcaa agcgcggaac       840
     ctcggcgtcg cgccgggcgg catctactac gctgaattca tgcatgcgta tggcgtcggc       900
     ttctacgcga ccggcaacga ccacggcgat atcggtctcg gcaatccgtg gatgtattgg       960
     gacgcggcca ccggcaggca actcgccgcg cagatccccg gcaaaggcac ggcgggcgac      1020
     atcttcctgc aggtgcaatt cccgctgcac tcggggcgca tcctcggtct cggcggacgg      1080
     attctgatta gcgcagtcgg cgttgcggtc gccgtgctga gcgcgaccgg attgctgatc      1140
     tggttaaaga agctgaatgc gcgccgccgc tccgcgcaaa atgcgagtgc cgcgcgggac      1200
     gcgggccggt ccgcggcgcg gccctag                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page