(data stored in ACNUC7421 zone)

EMBL: CP000270.PE355

CP000270.PE355       Location/Qualifiers
FT   CDS_pept        392359..392892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4106"
FT                   /product="single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4106"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28893"
FT                   /db_xref="GOA:Q145U6"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q145U6"
FT                   /protein_id="ABE28893.1"
FT                   /translation="MASVNKVILVGNLGADPEVRYLPSGDAVANIRLATTDRYKDKASG
FT                   EMKEATEWHRVSFFGRLAEIVSEYLKKGSSVYLEGRIRTRKWQAQDGTDRYSTEIVAEQ
FT                   MQMLGGRGGSMGGGGDEGGYSRGEPSERSGGGGRAASGGGSRGGSGGGAGGGASRPSAP
FT                   AGGGFDEMDDDIPF"
     atggcatccg tgaacaaggt cattctcgtc ggcaatctcg gagccgatcc ggaagtccgt        60
     tatcttccga gcggcgacgc agtggcgaac atccgccttg caacgacgga tcggtacaag       120
     gacaaggcgt ccggcgaaat gaaggaagcg accgagtggc accgtgtgtc gttcttcggc       180
     cgcctcgcgg aaatcgtgtc cgaatatctg aagaagggct cgtcggtgta cctggaaggg       240
     cgcatccgta cccgcaagtg gcaggcgcaa gacggcaccg accgttactc gaccgaaatc       300
     gtcgctgagc agatgcagat gctgggcggc cgcggcggct cgatgggcgg tggcggcgac       360
     gaaggtggtt atagccgcgg tgaaccgtcg gagcgcagcg gcggcggtgg tcgcgcggcg       420
     tccggtggtg gctcgcgtgg cggcagcggt ggcggcgccg gcggtggcgc gagccgtccg       480
     agcgcgccgg ctggcggcgg cttcgatgag atggacgacg atattccgtt ctaa             534
//

If you have problems or comments...

PBIL Back to PBIL home page