(data stored in ACNUC7421 zone)

EMBL: CP000270.PE357

CP000270.PE357       Location/Qualifiers
FT   CDS_pept        complement(394477..394908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4104"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4104"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28895"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q145U4"
FT                   /protein_id="ABE28895.1"
FT                   /translation="MPNFIKHIAFKVEDVEKERAFYENVFGYKHVNTVRRKGKNGDHIS
FT                   HHLTDGYMDLTLIHYESSDSDEADFAGPAPCIHHIGMEVEDLDAFIEQIKENGGEILTA
FT                   PGHLPVKFRSPNGPVAEVVPMQRWEKKTLAAGVHGEVLE"
     atgccgaatt tcatcaagca catcgcattc aaggtcgaag acgtcgagaa agagcgcgcg        60
     ttctatgaga acgtgttcgg ctacaagcat gtgaatacgg tgcgccgcaa gggcaagaac       120
     ggcgatcaca tttcgcatca cctgaccgac ggctatatgg atctgacgct gattcactac       180
     gagtcgtctg attcggatga agccgatttc gccggtccgg cgccgtgcat tcatcacatc       240
     ggcatggaag tggaagacct cgacgcgttc atcgagcaga tcaaggaaaa cggcggcgag       300
     atcctcacgg cgccgggtca tctgccggtc aagttccgct cgccgaacgg cccggttgcc       360
     gaagtcgtgc cgatgcagcg ctgggaaaag aagacactcg cggccggcgt gcacggcgaa       420
     gtactcgagt aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page