(data stored in ACNUC7421 zone)

EMBL: CP000270.PE359

CP000270.PE359       Location/Qualifiers
FT   CDS_pept        complement(395996..397381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4102"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4102"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28897"
FT                   /db_xref="GOA:Q145U2"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q145U2"
FT                   /protein_id="ABE28897.1"
FT                   /translation="MSVEKPEGPGVIAEKLGAWIADVHASALPDRTVEIARLLLLDVTG
FT                   LCIAGRGESYVRATLQATDPGGACTALGHAGSFSAFDAALINGTAAHGEDYDDTFEGGP
FT                   VHSGAVVVPAVLAACEREGLGGEALLRGIAVGAELMCRLSLVAPRAIHSAGFHPTAVIG
FT                   ALAAAGGVAAALRLEARQTTSALGIAGSMAAGIIEYLAEGTSTKRMHAGWAAQSGIRAA
FT                   LMARGGFDGPRTVLEGKHGFFKAFAPSRAPDFSPVLETLGESWIMETIAFKPYACGTMT
FT                   QPYIDCAIALAERGVQAEQIRDIVCEVGEGTVHRLWEELAVKHRPPTAYAAKFSTPFCM
FT                   AVGFFDRKAGFGQFTEARIHDPAVLALAGKIRYVIDPDNEYPDNFTGHLRATLNDGTVQ
FT                   EVRQPHMRGGAREPLTGAELAQKFVDNAQHGGWNAALADEARGWCETVFGEPALGTIAR
FT                   FRQ"
     atgagcgttg aaaaaccaga aggacccggc gtcattgccg aaaaactggg cgcctggatc        60
     gccgatgtgc atgcgtctgc attgccggac cggacggtcg aaatcgcccg tctgctgctg       120
     ctcgacgtaa ccggcttgtg cattgccggg cgcggcgaat cctatgtccg ggcgacgctg       180
     caggccaccg atccgggcgg cgcgtgcacg gcgctcggcc acgcgggcag cttcagcgcg       240
     ttcgatgcgg cgctgatcaa cggcaccgcc gcgcacggcg aagactatga cgacaccttt       300
     gaaggcggcc cggtgcattc gggtgccgtg gtcgtgcccg cggtgctcgc ggcctgcgaa       360
     cgcgaaggcc tcggtggcga agcattgcta cgcggcatcg ccgtcggcgc ggagttgatg       420
     tgccggctga gtctcgtcgc accgcgcgca attcatagcg ccggtttcca tccgaccgcc       480
     gtgatcggcg cacttgcggc agccggcggc gtcgcggccg cgctgcgcct ggaggcacgg       540
     caaaccacgt cggcgctcgg tattgcgggc agcatggcgg cggggatcat cgagtatctg       600
     gccgaaggca cgtcgaccaa acgcatgcat gccggctggg ccgcccagtc gggcattcgc       660
     gcggcgctga tggcgcgcgg cggcttcgac ggcccgcgca ccgtgctcga aggcaagcac       720
     ggtttcttca aggcgttcgc gccgtctcgc gcgccggatt tttcgccggt gctcgagacg       780
     ctcggcgagt cgtggatcat ggaaacgatc gcgttcaagc cctatgcgtg cgggaccatg       840
     acccagccgt atatcgattg cgccatcgca ctcgcggagc gcggcgtgca ggcggagcag       900
     attcgcgaca tcgtgtgcga agtcggcgaa ggcacggtgc atcgtctatg ggaagaactc       960
     gccgtcaagc atcggccgcc gaccgcttat gccgcgaaat tcagcacacc gttctgcatg      1020
     gccgtgggtt tcttcgatcg caaagcgggc ttcggtcaat tcaccgaagc ccggattcac      1080
     gatcccgcgg tgctcgcgct ggccggcaag atccgctacg tgatcgaccc ggataacgag      1140
     tatccggaca atttcaccgg ccatctgcgc gccacgctca acgacggcac cgtgcaggaa      1200
     gtgcgtcagc cgcatatgcg cggcggtgcg cgcgagccgc tgacgggcgc cgaactcgcg      1260
     caaaaattcg tcgacaacgc gcagcacggc ggctggaacg ccgcgctcgc cgacgaggcg      1320
     cgcggatggt gcgaaaccgt gttcggcgag ccggccctcg gcacgatcgc acggttccgg      1380
     caatag                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page