(data stored in ACNUC7421 zone)

EMBL: CP000270.PE36

CP000270.PE36        Location/Qualifiers
FT   CDS_pept        46582..50670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4426"
FT                   /product="Rhs family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4426"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28574"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q147B5"
FT                   /protein_id="ABE28574.1"
FT                   /translation="MPRGKLTPTQVQNFLNGGSGNTFGNPTQKQLPQSQRSISNPGGKG
FT                   GVNLKPTDPDWKEHFHEIMDMFGNIPVIGSLFNAINAGVYLAEGNVASAMENLGYVVMD
FT                   LIPGAGELKSAGNIGEDIGKLAEKTGTRLTEGEAEKAGKQIAEKQAEKQAEKRAEKRAE
FT                   KQAGEQAEKDGGKAEKEKQEACRNNKGVGHPVNPITGVKFLDGEEDLDFVLPCAVPLHW
FT                   QRSYFSNLVGNGWLGQGWSLPFSLCLKRVGYSVLMVDAQGHETRLPMLAPGERKRMDST
FT                   GFEVHRETSARYRFTSADCSTQYVFASLTVGEYDGAGQNDGTLPLVAIGDRYGNHQRLL
FT                   YDEAGMPALIHDAGGRVLRLQFTALPVDEGGTVQRLQRVVLGSQALVSYEYSPEGDLVR
FT                   VRDADGQATREYRYNNHILIEHSQPGALIARYEYDQYTLDGKVLRLENNLGQTWQFRYL
FT                   PSRTEVTDALGQTRCYLFNDQKMMVGQIDAAGNATRIDVDGQGNPLRVTDPAGGVRLAT
FT                   YDARGNMTSLTDAAGRRTEIQYHPQWQRPTLIVDAMGAATRVAYDAAGNLIRRTNALGH
FT                   VTGYAYDDDGRVIRITDAHGKHRHFAYDVHGRLTSHIDCSGRATHYGWDDWGHLALVTN
FT                   AAGETTRYWRNRRGRLLRTRHADGTGEEFTYDIHGRLIAHTDAHGASTQWERAADGLPV
FT                   TRIDALGHCLRYEYDAARRLQTLTNENGAPYRFTYDTAGRLVEQQGFDGRLIRYRYDAA
FT                   GWLTEQIELGAYEDHAAADGNHPDTLRTTYERDKAGRITATTISRAGDERTERITWRYD
FT                   AAGRLIEASNDCCRLERGYDAVGRLSSETSHVAGRSLTVSYEHDALGNHIRTTLPDGRH
FT                   IDYLYYGSGHLHQISIDGEVISDIERDALHREVSRTQGELVSHYQYDLQGRHIGQQTMG
FT                   RAVSGHSAITLISRTYRYDEVGNVREMTDRQSGVHRYRYDPLGQLIESEHETFALDPAH
FT                   NILDSRDLSPVVGNRVMQFGQHRYVYDMHGNVVEKISGAHTRIRLDYSPAHRIERARVA
FT                   RNGTEERVEYGYDALGRRVFRKNASGITLFVWEGNRLLSEVRDDRTFVYVYAHNSFVPV
FT                   AQIESRNAQNGRARDDLPIRYYHTDQIGLPYESTDDAGRTQWRARYAAWGRLLGANGGH
FT                   EQMHESGRQAHQPLRFQGQYFDEETGLHYNRHRYYDPDAGRFMTQDPIGLRGGINLYRY
FT                   APNPGRWIDPLGLAVDLSLVGPHYACNLNNFPNTFQVLGHGSPGGNIADLSGETLTPSE
FT                   LGDYMREASNYRQGQPVTLYACHLGAGGKNSYAQQLSNYLGADVNAPTDVLKTIDLGDG
FT                   DVMALVANGGGWQKFSPIC"
     atgccaaggg gaaaactgac accgacgcag gttcagaatt ttttgaacgg aggctcagga        60
     aatacgtttg gcaatccgac tcagaaacaa cttccacagt cacagaggag tattagtaac       120
     cctggaggca agggaggcgt taacttaaaa cccaccgatc cggactggaa agagcacttc       180
     cacgagatca tggatatgtt cggcaatata ccggtcatag gtagcttatt caacgcgatc       240
     aatgcgggcg tataccttgc cgagggcaac gtagcgagtg caatggagaa ccttggctac       300
     gtggtcatgg atctcattcc cggcgccggc gagcttaaat cggcgggaaa cataggtgag       360
     gatatcggga agctggcaga gaaaaccggt accaggctca ccgaggggga ggcggaaaaa       420
     gccgggaagc agatcgccga gaagcaggct gagaagcagg ctgagaagcg ggcggaaaag       480
     cgggcggaaa agcaggccgg cgagcaggcc gagaaggacg gaggcaaggc tgagaaggaa       540
     aagcaggagg cgtgcaggaa caacaagggc gtcggccatc cggtcaatcc gatcaccggc       600
     gtcaagttcc tggacggaga ggaagacctg gactttgtgc tgccttgcgc cgtgcctctg       660
     cactggcagc gcagctattt ttcgaatctg gtgggcaacg gctggcttgg acaaggctgg       720
     tcgctgccgt tctcgttgtg tctgaagcgg gtcggctact cggtattgat ggtcgatgcg       780
     caaggacacg aaacccgtct gccgatgctc gccccgggcg agcgcaaacg catggacagt       840
     acgggcttcg aagtgcaccg cgaaacgtcc gcccgttatc gattcacctc ggccgattgc       900
     agtacgcagt atgtgtttgc gtcgctcacc gtcggcgagt atgacggcgc cgggcagaat       960
     gacggcacgc tcccgctcgt tgccatcggc gatcgttacg gcaaccacca gcgtctgctg      1020
     tatgacgagg ccggcatgcc cgcgctcatc cacgacgctg gcggccgcgt gctgcggttg      1080
     caattcaccg cgctgcccgt ggacgaaggt ggaaccgtgc agcggttgca gcgcgtggtg      1140
     ctgggaagtc aagcactggt ctcgtatgag tactcgcccg agggtgatct ggtgcgcgtg      1200
     cgtgatgccg acggacaggc cacgcgcgaa taccgctaca acaatcacat tctgatcgaa      1260
     catagccagc ccggtgcgct gatcgcacgc tacgaatacg accagtacac gttggacggc      1320
     aaggtgttgc ggctcgagaa caacctcgga cagacctggc agttccgcta tctgcccagc      1380
     cggacggaag tgaccgatgc gctcggacag acgcggtgct atctgttcaa tgaccagaag      1440
     atgatggtgg gccagatcga tgccgccggc aacgcgacgc gtatcgatgt cgatggacag      1500
     ggcaatccgc tgcgcgtcac cgacccggcc ggcggcgtac gtcttgccac ttacgacgca      1560
     cgcgggaaca tgacctcgct caccgacgca gccggccgac gcaccgagat ccagtaccat      1620
     ccgcaatggc agcggcccac gctcatcgtc gatgcgatgg gcgcggcaac gcgcgttgcc      1680
     tacgatgcag cgggcaacct gattcgcagg acaaacgcgc tggggcacgt caccgggtac      1740
     gcttacgacg atgacggacg cgtcattcgc atcaccgatg cgcacggcaa gcaccggcac      1800
     ttcgcgtacg acgttcatgg ccggctcacg agtcatatcg attgctctgg acgggcaacc      1860
     cactacggtt gggatgactg gggacatctg gcgttggtga ctaacgccgc aggcgaaacg      1920
     acgcgctatt ggcgaaatcg caggggacgc ctgcttagga cccgtcacgc cgacggcacc      1980
     ggcgaggaat tcacttacga tattcacggt cgcctgattg cgcacaccga tgcgcacggg      2040
     gccagcacgc aatgggagcg ggccgccgat ggcctgccgg tgacgcgtat cgatgcgctg      2100
     gggcactgtc tgcgctacga gtatgatgcg gcgcgccgct tgcaaacgct gaccaatgaa      2160
     aacggcgcgc cgtaccgctt cacctacgat acggccggcc gtctggtcga gcaacagggt      2220
     ttcgacgggc gtctgatccg ttaccgctac gacgcggccg gatggttgac ggagcagatc      2280
     gaactgggcg cgtacgaaga tcacgcggcc gccgacggca accatcccga taccttgcgt      2340
     accacgtatg agcgggacaa ggccggacgc atcaccgcga caacgataag ccgcgcgggc      2400
     gacgaacgta ccgagcgcat cacatggcgg tatgacgcag ccggtcggct gattgaggcg      2460
     agcaacgatt gctgccgtct tgagcgcggc tacgatgcgg tgggccgact gagcagcgaa      2520
     accagccatg tcgcgggccg gtcgctgacg gtgagctacg agcatgacgc gttgggcaat      2580
     cacatcagaa cgacgttgcc ggacggccgc cacatcgact acctctacta tggttctggg      2640
     catttgcacc agatcagcat cgacggcgaa gtgatcagcg atatcgaacg cgatgcgctg      2700
     catcgggaag tgagccgcac gcagggggaa ctcgtcagtc actatcaata tgaccttcag      2760
     ggtcggcaca ttggacagca aacaatgggt cgcgccgtgt ccgggcattc ggcgatcacg      2820
     ctcatctcac gcacgtatcg gtatgacgag gtgggtaatg ttcgcgagat gacggatcgg      2880
     cagtccggtg tgcatcgcta ccggtacgat ccgctcggac aactgatcga atcagagcac      2940
     gagacttttg ccctcgatcc cgcgcacaac atcctggatt cgagggatct ttcgccggtc      3000
     gtcggcaatc gggttatgca gtttggacaa caccgctatg tctacgatat gcatggcaat      3060
     gttgtcgaaa agatcagcgg cgcgcacacg cgcatccgtc tcgactattc gccggctcat      3120
     cgaatcgaac gtgcgcgggt cgcccgcaac ggcaccgaag agcgagtgga atatggctac      3180
     gacgcactag gccgacgcgt gttcaggaag aacgcatcgg gcatcacgct gttcgtgtgg      3240
     gagggcaatc gcctgctgag tgaagtgcgg gacgatcgca cgtttgtcta cgtctatgca      3300
     cacaacagtt ttgtgcccgt cgcacagatc gagtcgcgta atgctcagaa cggccgggca      3360
     cgtgatgatc tgcccattcg ttactaccac accgatcaga tcggcttgcc ttacgagtcg      3420
     acggacgacg ctggacggac gcaatggcgc gcgcgctacg cggcatgggg caggttgctg      3480
     ggagcgaatg gcggtcatga gcagatgcat gagtccggca ggcaggctca ccagccgctg      3540
     cggttccagg ggcaatactt cgacgaagaa accggcctgc actataaccg gcaccgatat      3600
     tacgatccgg acgccgggcg tttcatgacg caggacccga tcgggctgag agggggcatc      3660
     aacctgtatc gttacgcacc caaccccggg cgatggattg atccgttggg gcttgcggtg      3720
     gatctttcgc tagtgggccc tcactacgca tgcaacctga acaattttcc taatacgttc      3780
     caggtgttag gtcatggctc gccagggggc aacatagcgg acctgtctgg cgaaaccctc      3840
     acgccgagtg aattgggcga ctatatgaga gaagcgtcga actacaggca ggggcagcct      3900
     gtgacgcttt atgcttgcca cctaggcgca ggcggaaaaa actcctatgc ccagcaactg      3960
     tccaattacc ttggcgcgga cgtgaatgcg ccgacagatg tattgaagac catcgacctt      4020
     ggagacggag acgtcatggc ccttgtcgct aacggcggag gatggcagaa attttcgccg      4080
     atttgctag                                                              4089
//

If you have problems or comments...

PBIL Back to PBIL home page