(data stored in ACNUC7421 zone)

EMBL: CP000270.PE367

CP000270.PE367       Location/Qualifiers
FT   CDS_pept        complement(406611..407369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4094"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4094"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28905"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="UniProtKB/TrEMBL:Q145T4"
FT                   /protein_id="ABE28905.1"
FT                   /translation="MDDKPAAASTTTSIVPSRRRFLINTVAVLPVAGSLAACQRPADAV
FT                   ASASGEAGTDSASPAAYQPKFFKPDEWRLIQAAIDRLIPADAEGPGALELDVAAFIDRQ
FT                   MEGAFGHAAGWYMKGPFHPDATPLAGYQSPMSPRDLYRTGIAALDGYCKAHFGGKGFVQ
FT                   LSAAQQDALLHGMDTGKVRFGQTSAGHFIALLWQNTKEGYFSDPIHGGNRHAASWTMIG
FT                   FPGARADYLDWVAQPGKVYPLGPATIEGKT"
     atggatgaca aacccgcggc ggcgtcaacg acgacttcca tcgttccatc acggcgccgg        60
     ttcctgatca acaccgtcgc agtcttgccg gtggcgggca gcctcgcagc gtgtcaacgc       120
     cccgccgacg ccgtggcgtc ggcgtcgggc gaggccggca cggacagcgc aagcccggcc       180
     gcgtaccagc caaagttttt caagcccgac gaatggcgtc tgattcaggc ggcgatcgac       240
     cgcctgattc ccgccgacgc ggaaggaccg ggcgcgctgg aactcgacgt cgcggcattt       300
     atcgacaggc agatggaagg cgccttcggc catgcggcgg gctggtacat gaagggtccg       360
     ttccatccgg acgccacacc gctcgcgggc tatcaaagtc cgatgtcgcc gcgcgacctt       420
     taccgcaccg gcattgcggc gctcgacggc tattgcaagg cgcacttcgg cggcaagggt       480
     ttcgtgcagt tgagtgccgc gcagcaagac gcgctgctgc atggcatgga taccggcaag       540
     gtcagattcg ggcagacctc tgccggtcat ttcatcgcgc tgttgtggca gaacacgaag       600
     gaaggctatt tctccgaccc gattcacggc ggcaacagac acgccgcaag ctggaccatg       660
     atcggttttc ccggcgcgcg cgccgactat ctcgactggg tcgcgcaacc cggcaaggtg       720
     tacccgctcg gtcccgcgac gatagaaggc aaaacatag                              759
//

If you have problems or comments...

PBIL Back to PBIL home page