(data stored in ACNUC7421 zone)

EMBL: CP000270.PE369

CP000270.PE369       Location/Qualifiers
FT   CDS_pept        complement(408125..408862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4092"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4092"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28907"
FT                   /db_xref="GOA:Q145T2"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="UniProtKB/TrEMBL:Q145T2"
FT                   /protein_id="ABE28907.1"
FT                   /translation="MHNAAQHSVVSDALAGFAVAALPASAESALGAARDALTHARLLTD
FT                   PATRSTAQITALLQSQGSATTDSRTRAWILGTSLATQAAASPAMPVLAAVIATGDKLGS
FT                   SESDAIAAVAIGTEAATRILAAVDSDEFRARWNVASSVGLLGAVLAVSRLLRLDEAHTR
FT                   HALGIAATQAAGLAHNADHAMEAIEIGKAAADALEAAMIAKHGFTSAAASIDGRRGFAA
FT                   LMAYRFDASAITDALGTRWTSLD"
     atgcataacg ccgctcaaca ttccgtcgtc tccgacgcgc tcgccggctt cgccgtcgcc        60
     gcgctgcccg cttcggccga gtccgcgctc ggcgccgcgc gcgacgcgct cacgcacgcc       120
     cgcctgctca ccgatccggc gacgcgctcc accgcgcaga tcaccgcact gctgcaatcg       180
     caaggcagcg cgacgaccga ctcgcgcacc cgcgcctgga ttctcggcac atcgctcgcg       240
     acccaggccg ccgcgtcgcc ggcaatgccg gtgctcgccg ccgtaatcgc caccggcgac       300
     aagctcggtt cgtccgaaag cgatgcgatc gccgccgtcg caatcggtac cgaagccgcc       360
     acgcgcattc tcgccgcggt cgatagcgac gagttccgcg cgcgctggaa cgtggcgtcg       420
     tcggtgggcc tgctgggtgc ggtgctggcg gtatcgcgcc tgctgcgcct cgacgaagcg       480
     catacgcgtc acgcgctcgg catcgcggca acccaggcag cgggactcgc gcacaacgcg       540
     gaccacgcaa tggaagcgat cgagatcggc aaggccgcgg cggacgcgct cgaagccgcg       600
     atgatcgcga agcacgggtt cacgagcgcg gccgcgtcga tcgacggacg gcgtggcttt       660
     gccgcgctga tggcgtatcg tttcgacgcc tccgccatta ccgacgcgct gggcacgcgc       720
     tggacttcgc tcgactga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page