(data stored in ACNUC7421 zone)

EMBL: CP000270.PE373

CP000270.PE373       Location/Qualifiers
FT   CDS_pept        412775..413275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4088"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4088"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28911"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q145S8"
FT                   /protein_id="ABE28911.1"
FT                   /translation="MESDVAVKTRIRASYGRYLEDFQVGDIYEHRPGRTITEADNIHFS
FT                   LLTMNFHPMHCDAAYAARSEFGRLLVNSGLTVAVVLGLSVNDVSGKAIANLGWKEIRLT
FT                   GPVFCGDTIYAESEVLDKRESKSRPGQGIVTVQTRAFKQDGTPIMDFVRSALVPARGHG
FT                   VGD"
     atggaatcag acgtcgcagt caaaacccgc attcgcgcca gttacgggcg ctacctcgaa        60
     gatttccagg tgggcgatat ctacgaacac cgtcccgggc gcactattac cgaagccgac       120
     aacatccact tctcgctgct gaccatgaac ttccatccga tgcattgcga tgccgcctac       180
     gccgccagaa gcgagttcgg ccgcctgctc gtgaatagcg gtctgacggt tgccgtggtg       240
     ctcggactct cggtgaacga cgtgagcggc aaggcgatcg ccaacctcgg ctggaaagag       300
     attcgcctga ccggcccggt gttctgcggc gacacgatct atgcagaatc cgaagtactc       360
     gacaagcgcg agtcgaagtc gcgtccgggg cagggcatcg tcaccgtgca gacccgcgcg       420
     ttcaagcagg acggcacgcc gatcatggac ttcgtgcgca gcgcgctggt gccggcacgc       480
     gggcacggcg tcggcgattg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page