(data stored in ACNUC7421 zone)

EMBL: CP000270.PE380

CP000270.PE380       Location/Qualifiers
FT   CDS_pept        complement(420328..421131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4081"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4081"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28918"
FT                   /db_xref="GOA:Q145S1"
FT                   /db_xref="UniProtKB/TrEMBL:Q145S1"
FT                   /protein_id="ABE28918.1"
FT                   /translation="MSEVGSTLVVFVLLLAATGVGVWVRPLLPEEHKAHETVQLIQLVI
FT                   GMLVTFAALVLGLMTASAKSSFDTASNDLRAYAADLIEFDTTLRDYGADTDPARRLLRQ
FT                   YTAAAIASTWPAETPPTGEYPKDIGPSQGNSEKLENTRLGDMLTAVGKELRQLRAHDPL
FT                   QQRALNDGLAQYRRVVDARWKLIEEAHSSISQPFLKTLTFWLGVIFLSFGLIAPRNALA
FT                   LVTISLGAVSIASAIYVIVDLDTPFTGPLVISSSPMRDALDHLSR"
     atgtctgaag tcggctcgac cctggtggtt tttgttctat tgctcgccgc caccggcgtg        60
     ggcgtgtggg tgcggccgct gttgcccgaa gagcacaagg cgcacgaaac cgtgcagttg       120
     atccagctgg ttatcggcat gctggtgacg tttgccgcat tggtactcgg cttgatgacg       180
     gcgtccgcga agtccagctt cgacacggca tcgaatgatc tgcgcgccta cgcggccgac       240
     ctgatcgaat tcgacacgac cttgcgcgat tacggcgcgg ataccgatcc ggcccggcgc       300
     ctgttgcgcc agtacaccgc ggcggcgatt gcctcgacgt ggcccgccga aacgccgccc       360
     acgggcgagt atccgaaaga catcgggcca tcgcagggca actcggagaa gctggagaac       420
     acgcggctcg gcgacatgct gaccgccgtg ggcaaggaat tgcggcaact gcgggcgcac       480
     gacccgctgc agcagcgcgc gctcaacgac ggattggcgc aataccggcg cgtggtggac       540
     gcgcggtgga agctcatcga ggaagcgcac agctcgattt cccagccgtt cctcaagacg       600
     ttgacgttct ggctgggcgt gatctttctg agtttcggcc tgatcgcgcc gcgcaacgcg       660
     ctggcgttgg tcaccatttc gctgggcgcg gtgtcgattg cttccgcgat ctatgtgatc       720
     gtcgatctgg atacgccatt taccgggccg ctggtgatct ccagttcgcc tatgagagat       780
     gcgctggacc acctgagccg gtga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page