(data stored in ACNUC7421 zone)

EMBL: CP000270.PE383

CP000270.PE383       Location/Qualifiers
FT   CDS_pept        complement(423959..425584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4078"
FT                   /product="Putative cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4078"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28921"
FT                   /db_xref="GOA:Q145R8"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033943"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q145R8"
FT                   /protein_id="ABE28921.1"
FT                   /translation="MFHAKRLVLAHFWLAFIAFLIALFLGAWQMLVRSPLLPWVGDPEL
FT                   YYRSVTAHGTVMAYVLPTLISMGFGYAIVELALAQRLVGLKWAWAAFIMLAVGAVMAMV
FT                   PVALGQASVLYTFYPPMIGSPFYYLGVVLVVVGSWIWVALMHVNLRIWKRANPGKPVPL
FT                   AMFANVAGAYLWAWTAIGAALEILFQILPVAFGLTNTIDAGLSRILFSWTLHAIVYFWL
FT                   IPAYIAYYTLVPRAIGGRLYSDSMARVSFILFLVFAMPIGIHHLFADPQVGSGFKFLHA
FT                   VFTGMVSVPTLLTVFTICASVEIAGRLRGGKGAFGWLTALPWQNPMMLVLAFSFVMLGL
FT                   GGAGGLINMSYQLNSTVHNTQWVTGHFHLIFGGAIVIMYFAIAYELWPQLTGRALASVK
FT                   LVRTQLWLWFIGMMVVTLPWHYVGLLGAPRRMAYYDYNTPGMQSQAFWVGMSAVGGLIL
FT                   VVSGVLFVYILARSQFGPVVQQQGFRFASATQPVERVPAALNSFGLWVALMIGLTVVNY
FT                   SVPIVQLLRLPQTSVPAVVVGAQR"
     gtgtttcacg ctaagcgact cgttctcgcg catttctggc tcgccttcat tgcgtttctg        60
     atcgcgctgt ttctcggcgc ctggcagatg ctggtgcgca gcccgctgct gccgtgggtc       120
     ggcgaccccg agctctacta tcgttcggta accgcgcacg gcacggtgat ggcctatgtg       180
     ctgcccacct tgatatcgat gggcttcggc tacgcaatcg tcgaactcgc gctcgcgcag       240
     cgcctcgtgg gtctcaaatg ggcatgggcc gctttcatca tgctggcggt gggcgcggtg       300
     atggcgatgg tgccggtggc gctcggccag gcctcggtgc tctacacctt ctatccgccg       360
     atgatcggca gtcccttcta ttacctcggc gtggtgctgg tggtggtggg ctcgtggatc       420
     tgggtcgcgc tgatgcatgt gaacctgcgc atctggaaac gcgccaaccc cggcaagccg       480
     gtaccgctcg cgatgttcgc caacgtggcg ggcgcgtatc tgtgggcatg gaccgccatc       540
     ggcgctgcgc tggaaatcct gttccagatc ctgccggtcg cgttcggcct caccaacacg       600
     atcgacgccg gcctgtcgcg catcctgttc tcctggacgc tgcacgcgat cgtctacttc       660
     tggctgattc ccgcgtatat cgcgtactac acgctggtgc cgcgcgcgat cggcggacgg       720
     ctctacagcg attcgatggc acgcgtgtcg ttcatcctgt tcctcgtctt cgcgatgccg       780
     ataggtatcc accatctgtt cgccgatccg caggtcggct ccggcttcaa attcctgcac       840
     gccgtgttca ccggcatggt gtcggtgccg acgctgctca cggtgttcac gatctgcgcg       900
     tcggttgaaa tcgccggcag gctgcgcggc ggcaagggcg cgttcggctg gctgaccgcg       960
     ctgccctggc agaacccgat gatgctcgtg ctcgcgtttt cgttcgtgat gctcggtctg      1020
     ggcggcgcgg gcgggctgat caacatgagc taccagttga actcgaccgt gcacaacacg      1080
     cagtgggtga ccgggcactt ccatctgatc ttcggcggcg cgatcgtgat catgtacttc      1140
     gcgatcgcct acgaactgtg gccgcaactg accggccgcg cgctcgcttc agtgaagctg      1200
     gtgcgcacgc aactgtggct gtggttcatc ggcatgatgg tggtgacgct gccgtggcac      1260
     tatgtcggcc tgctcggcgc accgcgccgc atggcctatt acgattacaa cacgccgggc      1320
     atgcaatcgc aggcgttctg ggtcggcatg tcggcggtgg gcggcctgat tctcgtggtg      1380
     tccggcgtgc tgttcgtcta cattctcgcc aggtcgcagt tcggcccggt ggtgcagcag      1440
     caaggcttcc gctttgccag cgcgacgcag ccggttgaac gcgtgccggc cgcgctcaac      1500
     agcttcggtt tatgggtggc gttgatgatc ggcctcacgg tcgtcaacta cagtgtgccg      1560
     atcgtgcagt tgctcagatt gccgcagacc tccgtgccgg cagttgtcgt cggagcacag      1620
     cgatga                                                                 1626
//

If you have problems or comments...

PBIL Back to PBIL home page