(data stored in ACNUC7421 zone)

EMBL: CP000270.PE394

CP000270.PE394       Location/Qualifiers
FT   CDS_pept        434895..439367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4067"
FT                   /product="amino acid-binding domain sensor hybrid histidine
FT                   kinase / PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4067"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28932"
FT                   /db_xref="GOA:Q145Q7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Q7"
FT                   /protein_id="ABE28932.1"
FT                   /translation="MSSVNFPPDVAMRRALERVRLCLLAWCLIAAAQTATAAQLFDNRS
FT                   NSQVVAAFPAKLTVGVLAGGWLPLDALQDGRLTGMSVDYLRALVGPNVVIEAKAFPDVS
FT                   QLLAAACAGNVDLLTSVARTPERERCLSFTAPYFRSSSSAVVRRDGDSYASPALIAGAR
FT                   IAVEKGFALERVARERFPHAQISAFATTHAALSAVVRGDADVYLGFTPAVQYALATEEF
FT                   RGLHVAFEESSRTANLRFAVPRSHAALRDQLDEALASMNPADEAAIRVRWLSGNFDAKP
FT                   VPTAPRLVLTPQEQAWLRSLPPLQIGFDNGWSPFSYVDSSGRPAGIAADYLAYLSRTLG
FT                   VVFNRARTADWPTAIESFQRGELAILATASIHDPRLKGARHTVAYESYPLVIVGREDEP
FT                   AARSLSDFASRRVVVSSHVAGSIPLAFERIPADHVVIAPSLDDALDMVAAGEADVLVGN
FT                   VAAIDILLKQRYDSVLKILGTVGESDALDFAVRTDLSPLAGLIDRALLAMPPAEKQRIR
FT                   QKWVTGNSPESGLWSVTAVRLLPLLIGIGVALLITLRAYLLLQREVRLRKKTELELELQ
FT                   LNFQETMMKMVPYPLVAIDLDGRYIAVNEAYEQACGMSREAVIGRNTVDVQTWGEANSR
FT                   ILTDMTREMLNGRETAQLELQFERGAGNVRHGLFWASVCRDGDGQPACVLGTVVDITDI
FT                   RRAEMRARETERRLFDVTRSLPAVVFQLRRTSDGAYSFPYIGGDTRHLLGGKDGSLNRS
FT                   DHVDFQRVCEEDRAFVLAELERSALCETPVNMEFRFEGDEEIKWARAELVPRREADDSV
FT                   VWSGYWVDASVEHARSDELARARDLAEAAARAKDDFFAMMSHEIRTPMNGVLGLVEVLE
FT                   RTPLNTDQGEMLGMIHESAGALLQILDDLLDYSKIEAGRLTIEAESIDIRELVDNAVGL
FT                   LAGRAHEKGLKVRVDIAPDVAATLRGDSVRLRQILFNLLGNAIKFTPQGEVDVRVSVFA
FT                   QADGVQTLEMTVEDTGIGIAPEVQNRLFEPFVQAESSTTRRFGGTGLGLTICRKLIDLM
FT                   GGSLALHSEPGSGTRMTVRLDMAVETQRYSVNGLRGKRGLVATGDARVAQALMHFGEAL
FT                   GLTLRRVPPDAPELRDRVALANLDLLFVNEDVTLPADVRPRTRVICLTEKPKPTGYRIL
FT                   DDNVRLSINPISWRGLGAACAAAMTGLPSVPRSAGTPRAPEGGPPPPDRERAIASGRLI
FT                   LVAEDHPVNQELIRHQLALLGFACDVTNDGAEALAALQRTSYGCLITDCHMPNVSGYEL
FT                   TRRIREGEEGGAHRLPILGITANTAPEDLNLCRDAGMDDSLVKPTRLATLRDYLSRWFG
FT                   SDSAAHAAPSESVGAPAIAATDVQGGADPFVPVDLGHMTQLWGSESTVKALLDSFVSSV
FT                   REDVQSLSPLLERVGSERTELERVREWLHRVAGAASVLQYPPLLMALEDYRREINVKPP
FT                   ERVRNDGMVLIDKCNAMLDGIEQQAALLV"
     gtgtcttccg tcaattttcc gccggacgtt gcaatgaggc gcgcgcttga acgcgtgcgg        60
     ctctgtctgc tcgcatggtg cctgattgcc gccgcccaga cggcaaccgc ggcccagctt       120
     ttcgacaatc gttcgaacag ccaggttgtc gcggcgtttc ccgcgaaact gacggtcggc       180
     gttctcgcgg gcggctggct gccgctcgac gcactgcagg acggtcgtct caccggtatg       240
     agtgtcgact atctgcgcgc gcttgtcggg ccgaatgtcg tcatcgaagc caaggcgttt       300
     cctgacgtat cgcaactgct tgccgccgca tgcgccggaa acgtcgatct gttgacgagc       360
     gttgcccgca caccggagcg tgagcgctgc ctgagtttta ccgcgccgta tttccgttct       420
     tcgtcgtcgg ccgtggttcg ccgcgacggt gacagttacg cgagtcccgc cctgatcgcc       480
     ggagcgcgca ttgcggtaga gaaggggttt gcactcgagc gcgtggcccg cgagcgcttt       540
     ccgcacgccc agatcagcgc gttcgccacg acgcacgcgg cactctccgc ggtggtccgg       600
     ggcgacgccg acgtctatct cggcttcacg ccggccgtgc aatacgcgtt ggccaccgag       660
     gagtttcgcg gcctgcatgt cgccttcgaa gagagcagcc ggaccgccaa tctgcgcttc       720
     gccgtgccgc gcagtcacgc tgcgttgcgg gaccagctcg atgaggcgct cgcgtcgatg       780
     aacccggccg acgaggcggc gattcgcgtg cgctggctgt ccggcaactt cgacgcgaag       840
     cccgtgccca ccgcgccacg tcttgtgctg acgccgcaag aacaggcctg gctgcgttca       900
     ttgccgccgt tgcagatcgg tttcgacaac ggctggtcgc cgttcagcta cgtcgacagc       960
     tccggccggc cggccggcat tgccgccgac tatctggcgt atttgagccg cacgctcggc      1020
     gtcgtattca accgtgcccg cacggctgac tggcccaccg ctatcgaatc gtttcagcgc      1080
     ggcgaactcg ccattctcgc cacggcgtcg attcacgatc cgcgactcaa gggcgcgcgg      1140
     cataccgtcg cttacgaaag ctatccgctg gtgatcgtcg ggcgtgagga cgaaccggcg      1200
     gccagatcgt tgagcgattt cgcatcgcgc cgcgtcgtcg tttcgtcgca cgttgccggt      1260
     tcgattccgc tcgcgttcga gcgaattccg gcggaccacg tcgttatcgc gcccagtctc      1320
     gacgacgcgc tcgacatggt cgcggcaggt gaggcggacg ttctggtggg caacgtggcc      1380
     gccatcgaca tcctgctcaa gcagcgctac gacagcgtcc tgaaaatcct cggcacggtc      1440
     ggcgaatccg acgcgctcga cttcgccgtg cgcacggacc tgagcccgct tgccgggctg      1500
     atcgaccgcg cgttgctggc catgccgccc gcggaaaagc agcgcatccg gcagaagtgg      1560
     gtcaccggta attcaccgga gtccggctta tggagcgtca ccgcggtgcg tctgctgccg      1620
     ttgctgatcg gcatcggcgt cgcgctgctg attaccttgc gcgcctatct gctgctgcaa      1680
     cgggaagtca ggctgcgcaa gaaaaccgaa ctcgaacttg aattgcagct gaatttccag      1740
     gaaaccatga tgaagatggt gccgtatccg cttgtcgcca tcgacctcga tggtcgctat      1800
     atcgccgtca acgaggccta tgagcaagcc tgcggaatga gccgcgaggc ggtgatcgga      1860
     cgaaacaccg tggacgttca gacgtggggc gaggccaaca gccggatcct gaccgacatg      1920
     actcgcgaga tgctgaacgg ccgggagacc gcgcagctgg aattgcagtt cgagcgcggc      1980
     gcgggcaacg tgcggcacgg cctgttctgg gccagtgtct gccgtgacgg cgacggtcaa      2040
     ccggcgtgcg tgctcggcac ggtggtcgat atcacggaca tccgccgcgc cgaaatgcgc      2100
     gcgcgcgaaa ccgaacggcg cctcttcgac gtgacgcgtt cgctgccggc ggtggtgttt      2160
     caactgcgcc gcacttctga tggcgcgtat tcgtttccgt atatcggcgg tgatacgcgg      2220
     catctgctgg gcggaaaaga cggctcgttg aaccgcagcg accacgtcga tttccagcgc      2280
     gtgtgcgagg aggaccgggc gttcgtgctg gcggaactcg agcgctcggc gctctgcgag      2340
     acgccggtga atatggagtt ccgtttcgaa ggcgacgagg agatcaagtg ggcgcgcgcg      2400
     gaactggtgc cgcgtcggga agcggatgac agcgtcgtgt ggagcggcta ctgggtggat      2460
     gccagcgtcg agcacgcccg ctccgacgag cttgcgcgag cccgcgacct ggccgaagcc      2520
     gccgcgcgcg ccaaagacga cttcttcgcg atgatgagcc atgaaatccg cacgccgatg      2580
     aacggggtgc tcggtctcgt ggaggtgctg gagcgcacgc cgctcaacac ggaccagggt      2640
     gaaatgctcg gcatgatcca cgagtcggcg ggtgcgttgc tgcagatcct cgacgacctg      2700
     ctcgactatt cgaaaatcga agccggccgg ttgacgatcg aggccgaatc catcgacata      2760
     cgtgaactgg tggacaacgc tgtcggcctg ctggccggcc gggcccatga gaagggtctg      2820
     aaagtgcgcg tggatattgc gccggatgtt gcagccaccc tgcgaggcga cagcgtccgg      2880
     ttgcggcaga ttctcttcaa cctgcttggc aatgcgatca agtttacgcc gcaaggcgag      2940
     gtcgacgtgc gcgtgtcggt gttcgcgcag gccgacggtg ttcagacgct cgaaatgact      3000
     gtcgaggaca ccggcatcgg catcgcgccg gaggtgcaga accggctgtt cgagccgttc      3060
     gtgcaggcgg aatcgtccac cacgcgccgc ttcggcggca cggggctcgg tttgacgatc      3120
     tgccgcaagc tgatcgatct catgggcggc tcgctcgcgt tgcacagcga accgggcagc      3180
     ggcacacgca tgaccgtgag actcgacatg gctgtcgaga cccagcgtta ttccgtcaac      3240
     ggtttgcgtg gcaagcgcgg gctcgtggca accggagacg cacgggttgc tcaagctttg      3300
     atgcacttcg gcgaggcgct aggactcacg ttgcgccgcg tgccgcccga tgcgccggaa      3360
     ctgcgcgatc gcgtcgcact ggcaaatctg gatttgctgt tcgtgaacga agacgtgact      3420
     ttgcccgcgg acgtacgccc gcgcacacgc gtcatttgcc tgaccgagaa gccgaagccg      3480
     accggttacc gcattctcga cgacaacgtg cgcctcagca tcaaccccat ttcgtggcgc      3540
     ggcctcggtg ccgcgtgcgc cgccgcgatg acagggctgc cttcggtgcc gcgctcggcg      3600
     ggcacgccac gtgcgcccga gggcggccct ccgccgccgg accgcgagcg ggccattgcg      3660
     agtggccggc tgatcctcgt ggcggaagat catccggtga atcaggagtt gatccgtcat      3720
     cagctcgcgc tactgggttt cgcctgcgac gtgacgaacg acggcgcgga agcgctggcc      3780
     gcattgcagc gcacgagcta cggatgtctg atcacggact gccacatgcc gaacgtgtcg      3840
     ggttatgaac tcacgcggcg tatccgtgaa ggtgaggagg ggggcgcgca tcggctaccc      3900
     attctgggta tcacggcgaa taccgcgccc gaagacctga atctgtgtcg ggacgccggt      3960
     atggacgaca gcctcgtgaa accaacccgg ctggccacgc tgcgcgacta tctgagccgt      4020
     tggttcggct ccgacagcgc ggcgcatgct gcgccttcgg agtccgtcgg agcacccgcg      4080
     atcgccgcaa cggatgttca aggcggcgcc gacccgttcg tcccggtgga cctggggcat      4140
     atgacccaat tgtggggaag cgaatcgacc gtcaaggcgt tgctcgactc gttcgtctcg      4200
     tcggtgcgcg aagacgtgca gtccttgtcg ccgttgctcg agcgcgtcgg ctccgagcgc      4260
     acggagctgg agcgcgtacg cgagtggctt catcgcgtgg cgggggcggc gagcgtcctg      4320
     caatatccgc cgctgctcat ggcgcttgaa gattaccgtc gcgaaatcaa tgtcaagccg      4380
     ccggaacgtg tgcgcaatga cggcatggtt ttaatcgaca agtgcaacgc catgctggac      4440
     ggaatagaac agcaggccgc attgctcgta taa                                   4473
//

If you have problems or comments...

PBIL Back to PBIL home page