(data stored in ACNUC7421 zone)

EMBL: CP000270.PE395

CP000270.PE395       Location/Qualifiers
FT   CDS_pept        439594..439869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4066"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28933"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Q6"
FT                   /protein_id="ABE28933.1"
FT                   /translation="MRKSLKTPFVHHVSVMFAWAALGNDGARRRFPSDIANVFCSSAAL
FT                   RITTDNYEVGVFHRSKVWRRERFPAAKRVAPSLFVRTLRDKRAQRI"
     ttgagaaaat cgcttaaaac gcctttcgtg catcacgtca gcgtcatgtt tgcatgggca        60
     gcgctcggta acgacggcgc gcggcggcgc tttccgagcg atatcgcgaa cgttttctgc       120
     tcatcggccg ctctccggat cactacggac aactacgaag ttggcgtgtt tcatcgttcg       180
     aaggtgtggc ggcgcgaacg gttcccggcc gcaaagcgcg tcgcgccctc gctgttcgtg       240
     cgcactctcc gcgacaaacg ggctcaacgg atttga                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page