(data stored in ACNUC7421 zone)

EMBL: CP000270.PE398

CP000270.PE398       Location/Qualifiers
FT   CDS_pept        complement(441414..442256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4063"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4063"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28936"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Q3"
FT                   /protein_id="ABE28936.1"
FT                   /translation="MEPSSLAAQSLSDDDLKALRRAKHELESPALAMKLASMVGAPLEK
FT                   LLSRMPAFANEKVADATELALRKCLAIALRTLGRRDGALALVAPEKPSNLLHKFAVATT
FT                   GAAGGAFGLFALPVELPVTTTLMFRSICDIARSEGEDLTSIDTQLQCLTVLGMGSTSSA
FT                   DDDADFGYFIMRGALAQAVSKASSEIATKGFTTHGSAALLRLVNTIAARFSVQVSEQIA
FT                   AKSIPAIGAVLGAMVNTVFIDHFQQVAHAHFTVRRLERQYGQQTVEAAYQTIDIALDG"
     atggagccga gttcgctcgc agcacaatcg ttatcggacg acgacctgaa ggcgctgcgg        60
     cgcgcgaaac atgaactgga gagccccgcg ctggcgatga aactggccag catggtcggt       120
     gcgccgctgg aaaagctgct ctcgcgcatg ccggcgttcg ccaacgaaaa agtcgcggac       180
     gcgaccgagc tggcgctgcg caagtgtctg gcgattgcgt tgcgcacgct ggggcgaagg       240
     gacggcgcgc ttgcgctcgt ggcgcccgag aaaccgagca atctgctgca caagttcgcc       300
     gtggcgacca ctggcgcggc cggcggcgca ttcggactgt tcgcgctgcc cgtcgaactg       360
     ccggtcacga ccacgctgat gttccgctcg atctgcgaca tcgcgcgcag cgagggtgag       420
     gatctgacct cgatcgacac gcaactgcaa tgtctgaccg tgctcggcat gggcagcacg       480
     tcgagtgccg acgacgacgc cgacttcggc tacttcatca tgcgcggcgc gctggcgcag       540
     gcggtgtcga aggcgtcgtc cgagatcgcc accaaaggtt tcaccacgca cggttccgcg       600
     gccttgctgc gcctcgtcaa cacgatcgcc gcgcgctttt cggtgcaggt gagcgaacag       660
     atcgccgcca agtcgatccc ggcgatcggc gcggtgctcg gcgcgatggt caatacggtg       720
     ttcatcgacc acttccagca ggtcgcgcac gcgcacttca ccgtgcggcg gctggagcgg       780
     caatacggcc agcaaacggt cgaggccgcg tatcagacca tcgacatcgc gctcgacggc       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page