(data stored in ACNUC7421 zone)

EMBL: CP000270.PE401

CP000270.PE401       Location/Qualifiers
FT   CDS_pept        complement(444667..445944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4060"
FT                   /product="Putative D-serine deaminase (d-serine
FT                   dehydratase) protein"
FT                   /EC_number="4.3.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4060"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28939"
FT                   /db_xref="GOA:Q145Q0"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="PDB:3GWQ"
FT                   /db_xref="UniProtKB/TrEMBL:Q145Q0"
FT                   /protein_id="ABE28939.1"
FT                   /translation="MKVTNYQGATIDPYSKGLGMVPGTSIQLTDAARLEWNLLNEDVSL
FT                   PAAVLYADRVEHNLKWMQAFVAEYGVKLAPHGKTTMAPQLFRRQLETGAWGITLATAHQ
FT                   VRAAYHGGVSRVLMANQLVGRRNMMMVAELLSDPEFEFFCLVDSVEGVEQLGEFFKSVN
FT                   KQLQVLLELGVPGGRTGVRDAAQRNAVLEAITRYPDTLKLAGVELYEGVLKEEHEVREF
FT                   LQSAVAVTRELVEQERFARAPAVLSGAGSAWYDVVAEEFVKASETGKVEVVLRPGCYLT
FT                   HDVGIYRKAQTDIFARNPVAKKMGEGLLPALQLWAYVQSIPEPDRAIIGLGKRDSAFDA
FT                   GMPEPARHYRPGNEAPRDIAASEGWEIFGLMDQHAYLRIPAGADLKVGDMIAFDISHPC
FT                   LTFDKWRQVLVVDPAYRVTEVIETFF"
     atgaaagtta caaactatca gggcgcgacg attgatcctt atagcaaggg cttgggcatg        60
     gttccgggta ccagcatcca gctcacggat gccgcgcgtc tggagtggaa cctgctgaac       120
     gaagacgtga gcctgccggc cgccgtgctg tacgcggacc gggtggagca caacctgaag       180
     tggatgcagg catttgtggc ggaatacggc gtgaagctcg cgccgcacgg caagactacg       240
     atggcgccgc aactgtttcg ccgccagctc gaaaccggcg catgggggat cacgctcgcc       300
     accgcgcatc aggtgcgtgc ggcttaccac ggcggcgtct cgcgcgtgct gatggccaat       360
     cagctggtcg gccgccgcaa catgatgatg gtcgccgagt tgctgagcga tccggaattc       420
     gaattcttct gcctcgtcga ttcggtggaa ggcgtcgagc aattgggcga gtttttcaag       480
     tcggtgaaca agcagttgca ggtgctgctc gaactcggcg tgccgggcgg ccgcacgggt       540
     gtacgcgacg cggcgcaacg caacgcggtg ctcgaggcga ttacacgcta tccggacacg       600
     ctgaagctcg ccggcgtcga actgtatgaa ggcgtgctca aggaagagca cgaggtgcgc       660
     gagtttctgc aaagcgcggt cgcggtgacg cgtgaactcg tcgagcagga gcgctttgcg       720
     cgtgcgccgg cagtgctgtc aggcgcgggg tcggcctggt acgacgtggt cgcggaggaa       780
     ttcgtgaagg cctcggagac cggcaaggtc gaggtcgtgc tgcgtccggg ctgctatctg       840
     acacacgatg tcggtattta tcgcaaggcg cagacggaca tcttcgcgcg caatccggtc       900
     gcgaagaaaa tgggcgaagg gctgcttccc gcgctgcaat tgtgggcgta tgtgcagtcg       960
     attcccgaac cggatcgcgc gatcatcggt ctgggcaagc gtgattccgc gttcgacgcg      1020
     ggcatgccgg agccggcgcg ccactatcgt ccgggtaacg aagcaccgcg cgatatcgcg      1080
     gcgagcgaag gctgggagat tttcggcttg atggatcagc atgcatatct gcggattccc      1140
     gcgggcgctg atctgaaagt gggcgacatg atcgcgttcg acatctcgca tccgtgtctg      1200
     acgttcgaca aatggcgtca ggtgctggtg gtcgatccgg cgtatcgggt cacggaagtg      1260
     atcgaaacgt ttttctga                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page