(data stored in ACNUC7421 zone)

EMBL: CP000270.PE409

CP000270.PE409       Location/Qualifiers
FT   CDS_pept        456919..457347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4052"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4052"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28947"
FT                   /db_xref="GOA:Q145P2"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q145P2"
FT                   /protein_id="ABE28947.1"
FT                   /translation="MDCVFCREDGGDVLWHDDTLRVVLADEHDYPGFCRVIWNGHVAEF
FT                   SDLDGNDRDRVMKAVYAVERAIRRILQPAKVNLASLGNQVPHVHWHVIPRFSNDAHFPL
FT                   PIWAPRQRTVSEAMLSSRRAQATLLREAVRQEIEQALG"
     atggactgcg ttttttgccg tgaagatggc ggcgatgtgc tgtggcacga cgacacgctg        60
     cgtgtcgtcc tagccgacga acacgattac ccgggctttt gccgggtgat ctggaacggc       120
     catgtcgccg aattttccga cctcgacgga aacgaccgcg atcgcgtgat gaaggccgtg       180
     tatgcggtcg agcgcgcgat ccggcgcatc cttcagccgg caaaggtgaa cctggcgagc       240
     ctcggcaacc aggtgccgca tgtgcactgg catgtgatcc cgcgtttttc gaacgacgct       300
     cattttccgc tgcccatctg ggcgccgcgc cagcgcacgg tgtccgaagc catgctgtcg       360
     tcgcgccgcg cgcaagccac cctgctgcgc gaagcggtgc ggcaggaaat cgaacaggcg       420
     ctgggttga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page