(data stored in ACNUC7421 zone)

EMBL: CP000270.PE41

CP000270.PE41        Location/Qualifiers
FT   CDS_pept        complement(55810..56088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4421"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28579"
FT                   /db_xref="UniProtKB/TrEMBL:Q147B0"
FT                   /protein_id="ABE28579.1"
FT                   /translation="MKRTWNSPTTREIVCKLPAKAEILSIFVRLCALTWGTTINCSAKG
FT                   NNLLQCSFGHLSCSNRREGRVGVAESEKIAKLSAPKENRPKAVLHAK"
     gtgaagcgaa cttggaattc tcctacgact cgcgaaatcg tgtgtaagtt gcccgccaaa        60
     gcggaaatat tgtcaatatt tgtgcgactg tgtgccttaa catggggcac gaccataaat       120
     tgttccgcga aaggcaacaa tctgctgcaa tgcagcttcg gtcacctttc ctgctcgaac       180
     agacgcgagg gtcgcgttgg cgttgcggaa tcagaaaaaa tcgccaagct gtcggcacca       240
     aaagaaaacc gcccgaaggc ggttcttcat gcgaagtga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page