(data stored in ACNUC7421 zone)

EMBL: CP000270.PE410

CP000270.PE410       Location/Qualifiers
FT   CDS_pept        457427..457840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4051"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4051"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28948"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:Q145P1"
FT                   /protein_id="ABE28948.1"
FT                   /translation="MSGLTPDTPVPTGVVVHSKSRVLELQYANGDSYRLPFELLRVYSP
FT                   SAEVMGHGPGQETLQTGKREVTITMIEGVGNYALQPTFSDGHATGIYSWDLLYDMAVRQ
FT                   DELWAAYLAKLQAAGVDRDTPMVQAGAAHGHCH"
     atgagtggtc tgactcccga tactccggtg ccgaccggcg tggtcgtgca ttccaaatcg        60
     cgtgtgctcg aattgcagta cgcaaacggc gattcgtatc gcctgccgtt cgagctgctg       120
     cgcgtgtatt cgccgtcggc ggaagtaatg ggccacgggc ccggccagga aaccctgcag       180
     accggcaagc gcgaagtgac gatcaccatg atcgagggcg tcggcaacta tgcgctgcag       240
     cccactttct ccgacggaca cgccaccggc atctattcct gggaccttct gtacgacatg       300
     gcggtgcgcc aggatgaact ctgggccgcg tatctcgcca aacttcaggc ggccggcgtc       360
     gaccgcgata cgcctatggt ccaggccggc gctgcgcacg ggcactgtca ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page