(data stored in ACNUC7421 zone)

EMBL: CP000270.PE413

CP000270.PE413       Location/Qualifiers
FT   CDS_pept        459823..460467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4048"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4048"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28951"
FT                   /db_xref="GOA:Q145N8"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:Q145N8"
FT                   /protein_id="ABE28951.1"
FT                   /translation="MTLAAKPFAAAVNHLLARETWARERLAPYAGKTAKLSCLPVVLML
FT                   LVQPDGYLSAVAAAEAQHFDVTIAVPSDALPAFVQGGQAAVMKHVKIEGDAEFATVIAK
FT                   LAEHLRWEPEEDLARLIGDGPAWRVASVMRTVGEQVQRAGRNLLDTAAEYLLDENPQLV
FT                   RRAALEDFNVELARARDALARVEKRIERLEQKVEARGAQAPGGAAMSRGTR"
     atgaccctcg ccgccaagcc attcgctgct gctgtcaatc atctgctcgc ccgcgaaacg        60
     tgggctcgtg agcgcctcgc cccgtacgcg ggcaagaccg cgaagctgtc ctgtctgcca       120
     gtcgtgctga tgctgctggt gcaaccggac ggctatctga gcgcggtcgc cgccgccgag       180
     gcgcaacact tcgacgtgac catcgcggtg ccgtccgacg cgctgcccgc cttcgtgcaa       240
     ggcggccagg cggcggtgat gaagcacgtg aagatcgaag gcgacgccga attcgccacc       300
     gtgatcgcga agctcgccga gcatctgcgc tgggagccgg aagaagacct ggcgaggctc       360
     atcggcgacg gcccggcgtg gcgcgtggcg tcggtcatgc gcacggtggg cgaacaggtg       420
     cagcgcgccg ggcgcaacct gctcgacacc gccgccgagt atctgctcga cgagaatccg       480
     caactggtgc gccgggcggc gctcgaggac ttcaacgtcg aactggcccg cgcgcgcgac       540
     gcactcgcac gcgtggaaaa acgcatcgag cgtcttgaac agaaggtcga agcccgcggc       600
     gcccaagcgc cgggcggcgc cgccatgtcg cgcggcacgc gctag                       645
//

If you have problems or comments...

PBIL Back to PBIL home page