(data stored in ACNUC7421 zone)

EMBL: CP000270.PE416

CP000270.PE416       Location/Qualifiers
FT   CDS_pept        462890..463291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4045"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4045"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28954"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q145N5"
FT                   /protein_id="ABE28954.1"
FT                   /translation="MPIYAYRCESCGFGKDVLQKMSDPQLTQCPECGKDTFRKQVTAAG
FT                   FQLKGSGWYVTDFRGGNGGTSAPAKPDANGASNGASGENAGANNGAAAQSTAAEGGSAA
FT                   AGSSNAAATPSAPAAAPAASASSSGSGSA"
     atgccgatct acgcttatcg ttgcgaatcg tgcggcttcg ggaaggatgt gctccagaag        60
     atgagcgatc cccagttgac gcagtgtccc gagtgcggga aagacacttt tcgcaagcag       120
     gtcactgctg cgggcttcca gttgaagggc tccggctggt atgtgaccga ttttcgcggc       180
     ggcaacggcg gtacgagcgc gcctgccaag cccgacgcca atggtgcctc gaatggcgcc       240
     tccggcgaga atgcgggcgc caataacggc gccgcagcac aatccacggc tgcggaaggc       300
     ggttcggccg cagccggttc atcgaacgcg gccgcaacgc cgtccgcgcc tgctgccgca       360
     ccggccgctt cggcgagttc gagcggttcc ggcagcgcct ag                          402
//

If you have problems or comments...

PBIL Back to PBIL home page