(data stored in ACNUC7421 zone)

EMBL: CP000270.PE417

CP000270.PE417       Location/Qualifiers
FT   CDS_pept        463307..464020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4044"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4044"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28955"
FT                   /db_xref="GOA:Q145N4"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:Q145N4"
FT                   /protein_id="ABE28955.1"
FT                   /translation="MGRRTRRALGFGPRGFLAVHMTTKKTTLKSVFLTGLLVLVPLAIT
FT                   LWVLGLIIGTMDQTLLLLPAAWQPERLFGFRLPGLGAVLTLAFIFVVGLLTQNFIGQKL
FT                   VKWWELLVGHIPVVGPIYTSVKQVSDTLLSSSGNAFRKALLIEYPRRGSYTIAFLTGIP
FT                   GGDVLNHLKEDHVSVYVPTTPNPTSGFFLMVPRSEVVELDMTVDAALKYIVSMGVVAPS
FT                   APPAPVRRTTVEPPL"
     gtggggcggc gcacacgccg cgcgttgggc ttcggcccgc gcggctttct ggcggtacac        60
     atgacgacga aaaaaacgac gctcaaatcg gtgttcctga ctggcctgct ggtgctggtg       120
     cctttggcca tcacgctgtg ggtgctcggc ctgatcatcg gcacgatgga ccagacgctg       180
     ttgctgctgc cggcggcctg gcagccggag cggctgttcg gttttcgcct gcccggcctc       240
     ggcgcggtgc tcacgctggc gtttatcttt gtcgttgggc tgttgacgca gaacttcatc       300
     ggccagaagc tcgtgaagtg gtgggaactg ctggtcggtc acattccggt ggtcggcccg       360
     atctacacca gcgtcaagca ggtgtccgac accctgctgt cgagcagcgg caacgcgttt       420
     cgcaaggcgc tgctgatcga gtacccgcgc cgcggctctt atacgatcgc gtttctgacc       480
     ggtattccgg gcggcgacgt gctcaaccat ctgaaagaag atcacgtcag cgtgtatgtg       540
     ccgactacgc cgaatcccac gtccggcttc ttcctgatgg tgcccaggag tgaagtggtc       600
     gagctcgaca tgacggtcga cgctgcgctc aagtacatcg tctcgatggg cgtcgtggcg       660
     ccgtccgcgc cgccggcgcc ggtgcgccgc acgacagtcg agcctccgct gtaa             714
//

If you have problems or comments...

PBIL Back to PBIL home page