(data stored in ACNUC7421 zone)

EMBL: CP000270.PE432

CP000270.PE432       Location/Qualifiers
FT   CDS_pept        484144..484482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4029"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28970"
FT                   /db_xref="UniProtKB/TrEMBL:Q145L9"
FT                   /protein_id="ABE28970.1"
FT                   /translation="MTSSPAKKLSVLLASVVLSVACAAPAFAQSGGGGGGPTGSDSDAA
FT                   VPSAASKAAPSTKAQRKAARKQARAKKNAELKKLEANGYQPSRNDPNYPNDIQNAQKKA
FT                   GIGTAASQ"
     atgacgtcgt cacctgcaaa gaaactgtct gtgttgctgg catcggttgt actgagcgtg        60
     gcatgtgccg cgccggcgtt cgcgcaaagc ggcggcggtg gcggcggtcc cacggggagc       120
     gattctgacg cggccgttcc gtcggccgcc tcgaaggcgg caccgagcac caaggctcag       180
     cgcaaggccg cgcgcaaaca ggcgcgggcg aagaaaaacg ccgagttgaa aaagttggag       240
     gccaacggtt atcagccgtc gcgtaacgat ccgaactatc cgaacgacat tcagaacgcg       300
     cagaagaagg cgggaatcgg cacggcggcg agccagtaa                              339
//

If you have problems or comments...

PBIL Back to PBIL home page