(data stored in ACNUC7421 zone)

EMBL: CP000270.PE436

CP000270.PE436       Location/Qualifiers
FT   CDS_pept        complement(488000..489091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4025"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4025"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28974"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q145L5"
FT                   /protein_id="ABE28974.1"
FT                   /translation="MTLPPLQDSTDTRLELLEAWLQGHAARYALELDTLVPASSDASFR
FT                   RYFRLAGKAAEGESGATLIAVDAPPPEKCREFVQVAQLLEAAGVHVPGVLEVDFEAGFM
FT                   LVTDLGTASYLGALTEAQNPDNPQDDPHRARTLMRDALDALIRWQLTSREGVLPPFDEA
FT                   FLRREMELMPEWFLGRHLGREADEKTRGVLDRTFALLIASARAQPQMFMLRDFMPRNLM
FT                   VAAGPAPVNPGVLDFQDAVYGPITYDVASLLRDAFLSWDEEFELDCFVYYWERARKAGL
FT                   PVDPDFGEFYRQLEWMGLQRHIKVLGLFCRINYRDGKPHYMKDLPRFIGYARKVAERYA
FT                   PLRPFARLLDDLEGRANEVGYTF"
     atgacgctgc ccccactcca agactccacc gacacccgtc tcgaactgct cgaagcctgg        60
     ctgcaaggcc acgcggcgcg ctatgcgctc gagctcgaca ccctcgttcc ggcttcgtcc       120
     gacgccagtt tccgccgcta tttccggctc gccggtaagg cggcggaagg cgaaagcggt       180
     gccacgctga tcgccgtcga cgccccgccg cccgaaaagt gccgcgagtt cgtgcaggtc       240
     gcgcaattgc tcgaagccgc cggcgtgcac gtgccgggtg tgctggaggt cgatttcgag       300
     gccggcttca tgctcgtcac ggatctgggc accgcttcgt accttggcgc gctgaccgaa       360
     gcgcaaaacc cggacaaccc acaggacgac ccgcaccgcg cccgcacgct aatgcgcgac       420
     gcgctcgacg cgctgatccg ctggcaactc acttcgcgcg aaggcgtgct gccgcccttc       480
     gacgaagcct tcctgcgccg tgagatggag ttgatgccgg agtggtttct cggccggcat       540
     ctgggccgcg aggccgacga aaaaacccgt ggcgtgctgg accgcacgtt cgcgctgctg       600
     atcgcgagcg cccgcgcgca gccgcagatg ttcatgctgc gcgacttcat gccgcgcaat       660
     ctgatggtcg ccgccgggcc cgcgccggtc aacccgggcg tgctggactt ccaggacgcg       720
     gtgtacggcc cgatcaccta cgacgtcgcc tccctgttgc gcgacgcgtt cctgagctgg       780
     gacgaggaat tcgagctgga ttgcttcgtg tactactggg agcgggccag aaaagccggt       840
     ctgccggtcg atcccgattt cggcgagttc taccgccagc tcgaatggat gggtctgcaa       900
     cggcacatca aggtgctggg cctcttctgc cggatcaact atcgcgacgg caaaccgcac       960
     tacatgaagg acctgccgcg tttcatcggc tatgcgcgca aggtcgccga acgctatgcg      1020
     ccgctgcgtc cgttcgcgag gctgctcgac gatctcgaag gccgcgcgaa tgaagtcggc      1080
     tacaccttct ga                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page