(data stored in ACNUC7421 zone)

EMBL: CP000270.PE44

CP000270.PE44        Location/Qualifiers
FT   CDS_pept        complement(60321..60698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4418"
FT                   /product="Putative thioredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4418"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28582"
FT                   /db_xref="GOA:Q147A7"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q147A7"
FT                   /protein_id="ABE28582.1"
FT                   /translation="MPALNLDTDQDRIAERVNEAETLFVACLCAQWCGTCREYRDAFDK
FT                   LADRHPEICFAWIDIETHADRFDDLDVENFPTILIEDSVTTRFFGTVLPHAAIVERMLS
FT                   DLTALPGVSGAPKLRPALATA"
     atgcccgcgc tgaatctcga caccgaccaa gaccggatcg ccgagcgcgt caacgaagcc        60
     gagacgctat tcgttgcctg cctgtgcgcg caatggtgcg gaacctgccg tgagtaccgg       120
     gacgcgttcg acaaactggc cgaccggcac ccggaaatct gtttcgcatg gatcgacatt       180
     gaaactcatg cggaccgatt cgacgatctg gatgtggaga attttccgac catactgatc       240
     gaagattcgg ttacgacgcg gttttttggc accgtgctgc cgcatgcggc gattgtggaa       300
     cggatgttgt ctgatctgac ggccctgccc ggcgtcagcg gcgcgcccaa actgcggccc       360
     gcgctagcca cggcgtga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page