(data stored in ACNUC7421 zone)

EMBL: CP000270.PE461

CP000270.PE461       Location/Qualifiers
FT   CDS_pept        complement(516919..518577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4000"
FT                   /product="Putative paraquat-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4000"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28999"
FT                   /db_xref="GOA:Q145J0"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q145J0"
FT                   /protein_id="ABE28999.1"
FT                   /translation="MTSPQEPTPAPDAPRNDSNGPKLPPQLPDPDIEPRSRWLPSLVWV
FT                   IPLIAALIGIALVIKSVTARGPTITISFVSAEGLEPGKTKVKYKDVDVGAVKTITLSKD
FT                   LSHVLVQVQLTKEGEDFAVKDSRFWVVRPRVGASGVSGLTTLLSGAYIGADAGHSPDTE
FT                   KNFVGLETPPPITGDQKGHQFILHGDSLGSIDIGSPIFYRRVQVGQVVGFSLDKDGTGV
FT                   TMQVFVSAPFDQYVGTNSRWWHASGVDLRLDSSGFKLNTQSLATVIVGGLSFQSPPGQG
FT                   VGAQAPNNMTFRLGSDEADAMREPDGVPLRVVMNFNQSLRGLSIGAPVDFRGIVLGQVT
FT                   NIGIDYDPKTRSFTMPVTMNLYPDRLGRRFRETAPAPGSLAGQTMLQQLVKHGLRGQLR
FT                   TGNLITSQLYVAVDIFPKAPPATVDVASDPLELPTIPNTLDELQLQVADIAKKLDAVPF
FT                   DQIGNNLNSALKNADQLFTRLDKEVVPQARDTLAAAKQTFGSAEATLQQDSPLQSDVHQ
FT                   ALQELTRTLQSLNALSDYLERHPESLLRGKSGDKP"
     atgactagcc cgcaagaacc gacgcccgcc cccgatgcgc cgcgcaacga ttcgaacgga        60
     ccgaagctgc cgccccaact ccccgaccct gacattgaac cgcgcagccg ctggctgcct       120
     tcgctcgtct gggtgattcc gctgattgcc gcgctgatcg gcatcgcgct cgtaatcaaa       180
     tcggtcaccg cgagaggccc gaccattacg atcagtttcg tcagcgccga aggcctcgaa       240
     cccggcaaga ccaaggtgaa gtacaaggac gtcgacgtcg gcgccgtgaa gaccatcacg       300
     ctgtcgaaag atctgtcgca cgtgctggtg caggtccagc tgaccaagga aggcgaagac       360
     ttcgcggtca aggattcgcg tttctgggtg gtgcggccgc gtgtcggcgc gagcggcgtg       420
     tcgggtctca ccacgctgct ctcgggcgcc tacatcggcg cggacgccgg ccattcgccg       480
     gataccgaga agaacttcgt cggcctggaa accccgccgc cgattaccgg cgaccagaag       540
     ggccaccagt tcatcctgca tggcgactcg ctcggctcga tcgacatcgg ctcgccgatc       600
     ttttaccggc gcgtgcaggt cggccaggta gtcggcttct cgctcgacaa ggacggcacc       660
     ggcgtgacca tgcaggtctt cgtgtccgcg ccgttcgacc agtatgtcgg caccaattcg       720
     cgctggtggc atgcgagcgg cgtcgatctg cggctcgatt ccagcggctt caagctgaac       780
     acccagtcgc ttgcaacggt gatcgtgggc gggctgtcgt tccagtcgcc gccgggtcag       840
     ggcgtaggcg cgcaggcgcc gaacaacatg accttccgcc tcggttcgga tgaagccgat       900
     gcgatgcgcg aaccggacgg cgtgccgctg cgcgtggtga tgaacttcaa ccagtcgctg       960
     cgcggcctgt cgatcggcgc gccggtcgat ttccgcggca tcgtgctggg ccaggtgacc      1020
     aacatcggca tcgactacga tccgaagacg cgcagcttca ccatgccggt gacgatgaac      1080
     ctctatccgg accggcttgg cagacgcttc cgcgagaccg cgccggcacc gggcagcctg      1140
     gcgggtcaaa ccatgctgca acagctcgtc aaacatggtc tgcgcggcca gttgcgcacc      1200
     ggcaatctga ttacgagcca gttgtacgtg gcggtggaca tcttcccgaa ggcgccgccg      1260
     gcaaccgtcg acgtggcgag cgatccgctc gaactgccga ccattccgaa cacgctcgac      1320
     gagttgcagc tccaggtcgc cgacattgcg aagaagctcg acgcagtgcc gttcgaccag      1380
     atcggcaaca acctgaacag cgcgctgaag aacgccgatc agctcttcac gcgactcgac      1440
     aaggaagtgg tgccgcaggc gcgcgacacg ctcgcggcgg cgaagcagac cttcggttcg      1500
     gccgaggcga ccttgcagca ggattcgccg ttgcagtccg atgttcatca ggcgttgcag      1560
     gaattgacgc gcacgttgca gtcgctcaat gcgctgtcgg attatctgga gcgccatccc      1620
     gaatcgctgt tgcgcggtaa atcaggagat aaaccatga                             1659
//

If you have problems or comments...

PBIL Back to PBIL home page