(data stored in ACNUC7421 zone)

EMBL: CP000270.PE463

CP000270.PE463       Location/Qualifiers
FT   CDS_pept        complement(519228..519983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3998"
FT                   /product="Putative paraquat-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3998"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29001"
FT                   /db_xref="GOA:Q145I8"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:Q145I8"
FT                   /protein_id="ABE29001.1"
FT                   /translation="MEHDNLIACHECDTLFRKPRLVGRTVARCPRCGATLYRGISRRLD
FT                   AVSAMTLGALITFLIAQGFPIVELETNGITSQTTLFGALIALWDEDMQIVAVMVFCSTI
FT                   LFPLTELVALLYVLIPLRAGYVPHAFNRVLRAIQFVRPWGMIEVFMLGILITIVKMVSL
FT                   ARVIPEAALFAFGVLTLMLAVVVTFDPRILWDLADELGARDQRPLPRTSADSAAAALNS
FT                   VAGPPAPPEVLGAEPSALPPVVPPAPRRG"
     atggaacatg acaacctgat tgcgtgccat gaatgcgata cgctgttccg caaaccccgg        60
     ctcgtcgggc gcacggtcgc gcgctgtccg cgttgcgggg ccacgctcta tcgcggcatc       120
     tcccgccggc tcgacgccgt cagcgcaatg acgctgggcg cgctgatcac cttcctgatc       180
     gcgcagggct tcccgatcgt cgaactcgaa accaacggca tcacctcgca gaccacgctg       240
     ttcggcgcgc tcatcgcgct atgggacgag gacatgcaga tcgtcgcggt catggtgttc       300
     tgctcgacca ttctgttccc gctgaccgaa ctcgtcgcgc tgctctacgt gctgatcccg       360
     ttacgcgccg gctatgtgcc gcacgccttc aaccgggtgc tgcgcgccat tcaattcgtg       420
     cgcccgtggg gcatgatcga agtcttcatg ctcggaatac tgatcaccat cgtgaagatg       480
     gtgagtctcg cgcgcgtgat tccggaagcg gccttgtttg cgttcggcgt gctcacgctg       540
     atgctcgccg tggtggtcac gttcgatccg cgcattctgt gggacctcgc cgacgaactg       600
     ggcgcccgcg accaacggcc gctgccgcgc acttccgccg acagcgcggc ggccgcgctc       660
     aactcggtcg cgggaccgcc cgcgccgccc gaggtgcttg gcgcggaacc gtccgccttg       720
     ccgccggtcg tgccgccggc accacgtcga gggtga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page