(data stored in ACNUC7421 zone)

EMBL: CP000270.PE466

CP000270.PE466       Location/Qualifiers
FT   CDS_pept        521620..522189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3995"
FT                   /product="Putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3995"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29004"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:Q145I5"
FT                   /protein_id="ABE29004.1"
FT                   /translation="MLIAFGALASSFSLGAFAAADTYQLDPTHTYPSFEADHFGGLSVW
FT                   RGKFTKSSGTVTLDRAAKTGTVDVTVDPASVDTGNGKLDEHLKSDAFFDVAKYPSVTYK
FT                   GTDIRFDGDKPVEVIGNLTIRGITKPLNLKIESFKCMQHPVLKREVCGVEASAHFNRAD
FT                   YGMDFGVKYGFSMDTKLHIQSEGIRQ"
     atgttgatcg ccttcggggc gctggcttct tctttctcat tgggcgcgtt cgcggccgct        60
     gatacctatc agctcgatcc gacccacacg tatccgagct tcgaggcgga tcacttcggc       120
     ggcctttcgg tgtggcgcgg caagttcacc aagagctccg gcacggtcac gctcgaccgc       180
     gcggcgaaaa ccggcacggt cgacgtgacg gtcgatcccg cctcggttga tacgggcaac       240
     ggcaagctcg acgagcatct gaagtcggac gcgttcttcg acgtcgccaa atatccgtcg       300
     gtaacctaca agggcaccga tatcaggttc gacggcgaca agccggtgga agtgatcggc       360
     aacctgacga ttcgcggcat caccaaaccg ctgaatctga agatcgagtc gttcaagtgc       420
     atgcagcacc cggtgctcaa gcgcgaggtg tgcggcgtgg aagcgagcgc gcatttcaac       480
     cgtgccgact acggcatgga tttcggcgtc aaatatggct tcagcatgga taccaaactg       540
     catatccagt ccgaaggcat caggcaatag                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page