(data stored in ACNUC7421 zone)

EMBL: CP000270.PE468

CP000270.PE468       Location/Qualifiers
FT   CDS_pept        complement(523885..524835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3993"
FT                   /product="protein translocase subunit secF"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3993"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29006"
FT                   /db_xref="GOA:Q145I3"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:Q145I3"
FT                   /protein_id="ABE29006.1"
FT                   /translation="MEFFRFRKDIPFMQRALIFNAISLLTFLAAVFFLLHRGLHLSVEF
FT                   TGGTVIEVQYPGAAPLEPVRGTLGKLGYADAQVQNFGTSRDVLIRLPLKQGYTSAQQSD
FT                   QVMSALKADTPQVQLQRVEFVGPQVGKELATDGLLALACVVIGIVIYLSFRFEWKYAVA
FT                   GVIANLHDVIIILGFFAFFQWEFSLSVLAAVLAVLGYSVNESVVIFDRIRETFRRERKL
FT                   SVIEVINHAITSTMSRTIITHGCTQMMVLSMFLFGGPTLHYFALALTVGILFGIYSSVF
FT                   VAAALAMWFGVKREDLIKDRKERTDADDPNAGAQV"
     atggaatttt tccgtttccg caaagacatt ccgttcatgc agcgcgcgtt gattttcaac        60
     gccatctcgc tgctaacgtt ccttgctgct gtgttcttcc tgctgcatcg cgggctgcat       120
     ctgtcggtgg agttcaccgg cggtacggtg atcgaagtgc agtatccggg cgccgcgccg       180
     ctcgaaccgg tgcgcggcac gctgggcaag ctcggttacg ccgacgccca ggtgcagaac       240
     ttcggcacct cgcgcgacgt gctgatccgt ctgccgctca agcagggcta tacgtccgcg       300
     caacagagcg accaggtgat gagcgcgctg aaggccgata ccccgcaggt gcaactgcag       360
     cgtgtcgagt tcgtcggccc gcaggtcggc aaggagctcg ccaccgacgg cctgcttgcg       420
     ctcgcctgtg tggtgatcgg catcgtgatc tacctgtcgt tccgcttcga atggaagtac       480
     gcggtggccg gcgtgatcgc gaacctgcac gacgtgatca tcattctcgg cttcttcgcg       540
     ttcttccagt gggagttctc gctgtcggtg ctggccgcgg tgcttgcggt gctcggctat       600
     tcggtgaacg aatcggtcgt tatcttcgac cggattcgcg agaccttccg ccgcgaacgc       660
     aagctgagcg tgatcgaagt catcaaccac gcgataacca gcacgatgtc gcgaaccatc       720
     atcacccacg gctgtacgca gatgatggtg ctctcgatgt tcctgttcgg cggcccgacg       780
     ctgcactact tcgctctcgc gctgacggtc ggtattctgt tcggtatcta ctcgtcagtg       840
     ttcgtcgccg cggcgctcgc catgtggttc ggcgtgaagc gcgaagatct gatcaaggac       900
     aggaaggaac gcaccgacgc ggacgatccg aacgcaggcg cgcaagtctg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page