(data stored in ACNUC7421 zone)

EMBL: CP000270.PE469

CP000270.PE469       Location/Qualifiers
FT   CDS_pept        complement(524856..526943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3992"
FT                   /product="SecD export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3992"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29007"
FT                   /db_xref="GOA:Q145I2"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:Q145I2"
FT                   /protein_id="ABE29007.1"
FT                   /translation="MNRYPLWKYAVMLVALVIGLVYTLPNLFGEAPAVQVSSGKATVKL
FT                   DSTTLSAVEAALAANQIKPDDVTFDNSATNANIRVRLPDTDTQLRVKDLLQKSLNSDPS
FT                   DPQYIVALNLQSASPRWLTALHALPMYLGLDLRGGVHFLLQVDMAGALNKKLDSDASDA
FT                   RTLLRDSNIRDGGVNRVNQTVVINFADQATADIASKQLGRSISELQWASQTGPDGGVQL
FT                   VGTFTPTVQKAVQDAALKQNITTLHNRVNELGVAEPVIQQQGSDRIVVELPGVQDTAKA
FT                   KDIIGRTATLEARLADPVNTHPNPSDPVPPGDELFTQGNQTPVLLRKQIIFTGDRIIDA
FT                   SAGFDEHQRPSVNIRLDSAGGRAVASVSRDNIGKPMAMVLFEKGKGEVLTVATIQSELG
FT                   DRFQITGQATPQGAADLALLLRAGSLAAPMDIIEERTIGPSLGADNIRKGFHSVVWGFA
FT                   AIAVFMIAYYMLFGVISMIGLSVNLLLLIAVLSMLQATLTLPGIAAIALALGMAIDANV
FT                   LINERVREELRNGAPPQLAIQNGYAHAWATILDSNVTTLIAGIALLAFGSGPVRGFAIV
FT                   HCIGILTSMFSAVFFSRGIVNLWYGGKKKLKSLAIGQVWRPDTAPAGSAAYLGSEDAST
FT                   DTAQAVAAVAAKPSKARAAVAQARAGKPTVRRRNAPGSSTGTPGSSPGSTNTPQKPGSS
FT                   R"
     atgaatcgtt accccctctg gaaatatgcc gtgatgctgg tggctctggt catcggcctc        60
     gtgtacacgc tgcccaacct gttcggcgaa gcgccggcgg tgcaggtgtc gagcggcaag       120
     gcaacggtca agctcgactc gaccacgctg tcggctgtcg aagccgcgct cgccgcgaat       180
     cagatcaagc cggacgacgt cacgttcgac aactcggcga ccaacgcgaa catccgcgtg       240
     cgtctgccgg acaccgacac gcagctgcgc gtgaaggacc tgctgcagaa gtcgctgaac       300
     agcgacccga gcgacccgca gtacatcgtc gcgctgaatc tgcaaagcgc gtcgccgcgc       360
     tggctgaccg ccttgcacgc gctgccgatg tacctcggcc tcgatctgcg cggcggcgtt       420
     cacttcctgc tgcaggtcga catggccggc gcgctgaaca agaagctcga ttcggacgct       480
     tcggacgcgc gcacgctcct gcgtgacagc aatatccgcg acggcggcgt gaaccgcgtg       540
     aaccagacgg tggtgatcaa tttcgccgac caggcgacgg cggacatcgc atcgaagcaa       600
     ctgggccgca gcatcagcga actccagtgg gcctcgcaaa ccggtcccga cggcggcgtg       660
     caactggtcg gcacgttcac gccgacagtg cagaaagccg tgcaggacgc cgcgctcaag       720
     cagaacatca ccacgctgca taaccgcgtg aacgaactcg gcgtggccga gccggtgatc       780
     cagcagcaag gctccgaccg tatcgtggtc gaactgccgg gcgtgcagga cacggcgaag       840
     gcgaaggaca tcatcggccg cacggcaacg ctcgaagcgc gcttggccga cccggtcaac       900
     acgcatccga acccgtccga tccggtgccg ccgggcgacg aactgttcac gcagggcaac       960
     cagacgccgg tactgctgcg caagcagatc atcttcacgg gcgaccggat tatcgacgcg      1020
     tcggcgggct tcgacgagca tcaacgtcct tccgtcaaca tccgtctgga ttcggccggc      1080
     ggccgtgcgg tcgccagcgt gtcgcgcgac aacatcggca agcctatggc gatggtgctg      1140
     ttcgaaaagg gcaagggcga agtgctgacg gtggcgacca tccagtcgga actgggcgac      1200
     cgcttccaga tcaccggcca ggccacgccg caaggcgccg ccgacctcgc gctgctgctg      1260
     cgcgctggtt cgctggccgc gccgatggac atcatcgaag aacgcacgat cggcccgagc      1320
     ctcggcgcgg acaacatcag gaagggcttc cactcggtgg tgtggggctt cgcggcgatc      1380
     gccgtcttca tgatcgcgta ctacatgctg ttcggcgtga tctccatgat cggcctgtcg      1440
     gtcaacctgc tgctgctgat cgcggtgctg tccatgctgc aggccacgct caccctgccg      1500
     ggtatcgccg ctatcgcgct cgcactcggt atggcgatcg acgcgaacgt gctgatcaac      1560
     gagcgggtgc gcgaggaact gcgcaacggc gcgccgccgc aactggccat ccagaacggc      1620
     tacgcgcacg cctgggcaac gattctcgac tcgaacgtca ccacgctgat cgccggtatc      1680
     gcgctgctcg cattcggctc ggggccggtg cgcggctttg cgatcgtgca ctgtatcggc      1740
     attctcacgt cgatgttctc ggcggtgttc ttctcgcgcg gcatcgtcaa cctctggtac      1800
     ggcggcaaga agaagctgaa gtcgctggcc atcggccagg tgtggcgtcc ggatacggcg      1860
     cccgcaggct cggcggctta cctcggtagc gaagacgcct ccaccgacac cgcgcaagcc      1920
     gtcgccgcgg tcgccgccaa gccgtcgaag gcgagagccg cggtcgcgca ggcacgcgcc      1980
     ggcaagccga ccgtacgccg ccgcaatgcg ccggggtcgt cgaccggtac gccgggttca      2040
     tcgccgggtt ccacgaatac accgcagaaa ccgggttcgt cccgctga                   2088
//

If you have problems or comments...

PBIL Back to PBIL home page