(data stored in ACNUC7421 zone)

EMBL: CP000270.PE480

CP000270.PE480       Location/Qualifiers
FT   CDS_pept        complement(538510..539208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3981"
FT                   /product="Protein of unknown function UPF0001"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3981"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29018"
FT                   /db_xref="GOA:Q145H1"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q145H1"
FT                   /protein_id="ABE29018.1"
FT                   /translation="MPDLIHNLEAVRQRIATAAHVAGRDTRSIHLLAVSKTFPAEDVRA
FT                   AYAAGQRAFGENYVQEAITKIEALADLRATIEWHFIGPLQSNKTRPVAEHFDWVHSVDR
FT                   LKIAQRLSEQRPDNLPPLNVCLQVNISGEASKSGVGIAEAAQVAQAIAALPKLKLRGLM
FT                   AIPEPAGSIDEQRVPHRQLRELFERLRDGGLALDTLSMGMSSDLEAAVLEGATIVRVGT
FT                   AIFGARDYSN"
     atgcccgatc tgattcacaa cctcgaagcg gtgcggcagc gcatcgccac ggccgcgcac        60
     gtggccggac gcgatacacg ttcgatccat ctgctcgcgg tctcgaagac tttccccgcc       120
     gaagacgtgc gcgccgccta cgctgccggc cagcgcgcgt tcggcgagaa ctacgtgcag       180
     gaagccatca ccaagatcga ggcgctcgcc gatctgcgcg ccacgatcga atggcatttc       240
     atcggccctt tgcaatcgaa caagacgcgc cccgtcgccg agcatttcga ctgggtgcac       300
     tcggtcgacc ggctgaagat cgcgcagcgg ctttcggagc agcggccgga caatctgccg       360
     ccgctgaacg tgtgtctaca ggtcaacatc agcggcgagg cgtcgaagag cggcgtcggc       420
     attgccgagg cggcgcaggt cgcgcaggcg atcgccgcac tgccgaagct taagctgcgc       480
     ggcctgatgg cgattcccga accggccggg agcatcgacg agcaacgcgt gccgcatcgg       540
     cagttgcgcg agttgttcga gcgtctgcgc gacggcggac tcgcactcga tacgctgtcg       600
     atgggcatgt cgagcgacct cgaggccgcc gtactggaag gcgcgaccat cgtgcgcgta       660
     ggcaccgcga tcttcggcgc gcgagattac tctaactga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page