(data stored in ACNUC7421 zone)

EMBL: CP000270.PE49

CP000270.PE49        Location/Qualifiers
FT   CDS_pept        64646..65536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4413"
FT                   /product="Heat shock protein, Metallo peptidase, MEROPS
FT                   family M48B"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4413"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28587"
FT                   /db_xref="GOA:Q147A2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:Q147A2"
FT                   /protein_id="ABE28587.1"
FT                   /translation="MNPALGQGVADMFNWVKTAMLMAAITALFIVIGGMIGGSRGMTIA
FT                   LVIALGMNFFSYWFSDKMVLRMYNAQEVDETSAPQFYRMVRELSTRAGLPMPRVYLINE
FT                   DAPNAFATGRNPEHAAVAATTGILRVLSEREMRGVMAHELAHVKHRDILISTVSATMAG
FT                   AISALANFAMFFGGRDENGRPTNPIASIAVALLAPIAGALIQMAISRAREFEADRGGAQ
FT                   ISGDPQALASALDKIHRYASGIPFPTAEQHPATAQMMIMNPLAGGGIANLFSTHPATEE
FT                   RIARLMEMARTGRFE"
     atgaaccccg cgttagggca aggagttgca gacatgttca attgggtcaa aaccgcgatg        60
     ttgatggccg cgatcacggc ccttttcatc gtgatcggcg ggatgatcgg cgggtcgcgc       120
     ggcatgacga tcgcgctcgt gatcgccctt ggaatgaatt tcttttcgta ctggttctcg       180
     gacaagatgg tgctgcgcat gtacaacgcg caggaggtcg acgaaaccag cgcgccgcag       240
     ttctatcgca tggtgcgcga gctttccacg cgcgccggcc tgcccatgcc gcgcgtgtac       300
     ctgatcaatg aagatgcgcc gaacgcgttc gccaccggcc gcaatccgga gcatgcggcg       360
     gtcgccgcca ccaccggcat tctgcgtgtg ctgtccgagc gcgaaatgcg cggcgtgatg       420
     gcgcatgaac tcgcgcacgt gaagcatcgc gacattctga tttcaaccgt ctcggccacg       480
     atggccggcg ccatttccgc gctggcgaac ttcgcgatgt tcttcggcgg gcgcgacgaa       540
     aacggtcggc ccacgaaccc gatcgcgagc attgcggtcg cgctgctggc gccgatcgcc       600
     ggtgcgctga ttcagatggc gatttcgcgg gcacgtgaat tcgaagccga ccgcggcggc       660
     gcacagattt ccggcgaccc gcaggcgctc gcttcggcgc tcgacaagat ccaccgttac       720
     gcgagcggga ttccgtttcc caccgccgag cagcatccgg ccaccgcgca aatgatgatc       780
     atgaatccgt tggcgggcgg cggcatcgcg aatctgttct ccacgcaccc ggctaccgag       840
     gaacgcatcg cacgtttgat ggaaatggcg cgcacggggc gcttcgaata a                891
//

If you have problems or comments...

PBIL Back to PBIL home page