(data stored in ACNUC7421 zone)

EMBL: CP000270.PE491

CP000270.PE491       Location/Qualifiers
FT   CDS_pept        complement(550473..554765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3970"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3970"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29029"
FT                   /db_xref="GOA:Q145G0"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:Q145G0"
FT                   /protein_id="ABE29029.1"
FT                   /translation="MQTGFAGSPSTLSRVLHFVVNLQNYHTPTRRSMSERNESADPHET
FT                   GQVRPVSGSDHIVLRRTFHVVLAIALVLYFVATGLFLALRYVVLPRADSFRPRIEAIVS
FT                   EKLHAQFSIGKLAPYWSGFQPGLDVTNLVIRDRDGKTALTIPHATATLSWKSLWQFHPA
FT                   LSSLIVDQPDVLVARSSDGVLSVAGVPVPTRHSGNDVLTTWLLRQQAIVVRGGVLRWRD
FT                   AEHAAPELALRDIRIAILNDGYDHRLALQAPAEGHVLNGPLDFRTHFRHAPLSAIGKPI
FT                   NWTGQVYVSTGPVDLPTLARYVNFPIETFAGRIDNAIWIDFADGRMKSASGQLTGADVA
FT                   MRVRPTQPKLLVPVASFMWRLEAEAGDYKLQLSQFHAELGQPPLDDGTPLTRTLALTTL
FT                   NGRYRTASQQHGQLVSVSGDRVDLGILAEFSRALPLSRRLLNNLVRYNPRGLVANYLIE
FT                   VERAKPESGEAGSDHQPSGAEPIERYRFKGDLQGISVAAQEPPPGLTPLNHPRAGIPGI
FT                   ENLWGSVDADETHGTALLDTSNVAITLPGVFDDPRLKLDRLHGRADWTITPKAPGENHP
FT                   AFTVKLADFGVSNADVAATATADYSNPGHGRGSLDLKADFQRAQVTRIARYLPTSIGEK
FT                   LRIYLGHGLQAGMSHGATIEVHGDLTKFPYSRDPSAGLFHIVAPFKGGKFDPTPYPPRK
FT                   MRNGTPNVWPALDGIDGVFELRQNVMRFDIDRAHYKQVALTGVNGRIDDLGTRASSLVI
FT                   KGDGHGPLADMLDYVNASSLGIMAKHETDKVRAEGPASLALKLTVPRTPKPHIGVEGAV
FT                   GFQNNRLSVENVPPLSQLKGKVRFTEHTAQVDRLSGQFLGGDVHANGGLKQDGTYALDL
FT                   GGHIAVDAARGLDLHGPGAQVLTRMSGSAPYALNVRGAKGRLPEVTANSDLTGLALDFP
FT                   APFNKPVGAPMPLRFAVSPSAAPGEAGLERADLTFGPLAAAYLLRYQPKTPPTVVRGAV
FT                   GVNRPADLPSEGVIAAVDLDTFDADAWRALVTQIRTKDAPAPASVTPAPATPNPTVAQF
FT                   LPSRFALHVGTLTLLKRHWDSVIVGASHADRTWQANIASNQVSGHVSWLPGPTRESPGT
FT                   LQARFARVVIPSATDKDLLGEVMSAPAQNMPSIDLVVNELIVRDHNVGRLEVDAHNFDE
FT                   DGVPVWQLDKLDITNPAATLSATANWRTSTDLGSSADEATARRTVFDFKLDIKDAGALL
FT                   ERFGQPRTLKAGAGSLSGKMVWQGGPTRIDYPTLNGNLAVDLRHGQILKVDPGVAKLLG
FT                   VLSLQSLARFATLNFRDVIGEGLPFEHVTGTAQIHNGIGRTENFEMVTAPARAEMKGSV
FT                   DLAQETQDLHVQIVPTVSAGAAVIAATVINPLLGLGALVADLAFSQSVSHAFAREYAIT
FT                   GSWSKPHVERVKGDRGKMDAPASTVEAH"
     atgcagacag ggtttgcagg aagtccgtct acgctttccc gtgtgttaca tttcgtcgtc        60
     aatttgcaaa actaccatac gcccacccgc cgcagcatgt ccgagcgaaa cgaatccgcc       120
     gaccctcacg aaaccgggca ggtccggcct gtgagcggaa gcgaccacat cgtgctgcgc       180
     cggacctttc acgtggtcct cgcgatcgcg ctcgtgctgt actttgtagc gaccgggctg       240
     tttctcgcgt tgcgttacgt ggtgctgccg cgcgccgact cgttccgccc gcgcatcgaa       300
     gccatcgtct cggagaaact gcacgcgcag ttcagcatcg gcaagctcgc gccgtactgg       360
     agcggcttcc agcccggcct cgacgtcacc aatctcgtga tccgcgaccg cgacggcaag       420
     accgcgctga cgattccgca cgccaccgcc acgctctcgt ggaagtcgct ctggcagttt       480
     catccggcgc tgtccagcct gatcgtcgat cagccggacg tgctggtggc acgtagcagc       540
     gacggcgtgc tctcggtagc tggcgtgccg gtgcccacgc gccacagcgg caacgacgtg       600
     ctgaccacct ggctgttgcg ccaacaggcg atcgtggtgc gcggcggcgt gctgcgctgg       660
     cgcgatgcgg agcacgccgc gccggaattg gccctgcgcg atatccggat cgcgattctc       720
     aacgacggct acgatcaccg gctggcgctg caggcgcccg ccgaagggca tgttctgaac       780
     ggcccgctcg atttccgcac gcatttcaga cacgcgccgc tctccgcaat cggcaagccg       840
     atcaactgga ctggccaggt gtacgtgtcg accggcccgg tcgatctgcc gaccctcgcg       900
     cgctacgtca atttcccgat cgagacgttt gccggccgca tcgacaatgc aatctggatc       960
     gacttcgccg atggccgcat gaagtcggca agcgggcaac tcaccggcgc cgacgtcgcc      1020
     atgcgggtgc gtccgaccca gccgaagctg ctcgtgccgg tcgccagttt catgtggcgc      1080
     ctcgaagccg aggcaggcga ctacaaactg caactgagcc agtttcacgc cgaactcggc      1140
     cagccgccgc tcgacgacgg cacgccgctc acgcgcacgc tcgcgctcac cacgctgaac      1200
     ggacgctacc ggaccgcctc gcagcaacac gggcaactgg tcagcgtaag cggcgaccgg      1260
     gtcgacctgg gcatcctcgc ggaattcagc cgcgcgttgc cgctgtcgcg gcgtctgttg      1320
     aacaatctcg tgcgctacaa cccgcgcggc ctggtggcca attatctgat cgaagtcgag      1380
     cgcgccaaac cggagtcggg cgaagcgggc agcgaccatc agccgagcgg cgccgagccg      1440
     atcgagcgct atcgcttcaa gggcgatctg caaggcatca gtgtcgccgc ccaggaaccg      1500
     ccgccggggc tcacgccgct gaatcacccg cgcgcgggca ttcccggcat cgagaatctg      1560
     tggggcagcg tggacgccga cgaaacccac ggcaccgccc tgctcgacac ctccaacgtc      1620
     gccattacgc tgccgggcgt gttcgacgac ccgcgtctga agctcgaccg tctgcatggc      1680
     cgcgccgact ggaccatcac gccgaaggcg ccgggcgaga accacccggc cttcaccgtg      1740
     aagctggccg atttcggcgt ttcgaacgcc gacgtcgcgg ccaccgccac cgccgactac      1800
     agcaacccgg gccacgggcg cggttcgctc gatctgaaag ccgacttcca gcgcgctcag      1860
     gtgacgcgca tcgcccgcta tctgccgacc agcatcggcg aaaagctgcg catctatctg      1920
     ggccacggct tgcaggccgg catgtcgcac ggcgcgacca tcgaggtgca cggcgacctg      1980
     accaaattcc cctattcgcg cgacccgagc gccggactgt tccatatcgt cgcgccgttc      2040
     aagggcggca agttcgatcc gacgccgtac ccgccgcgca agatgaggaa cggcacgccg      2100
     aacgtatggc cggcgctcga cggcatcgac ggcgtattcg aactcaggca gaacgtgatg      2160
     cgcttcgaca tcgaccgggc gcattacaag caggtcgcgc tcaccggcgt caacggcagg      2220
     atcgacgacc tcggcacccg ggcgtcgagc ctcgtcatca agggcgacgg ccacgggccg      2280
     ctcgccgaca tgctcgacta cgtgaacgcc agctcgctcg gcatcatggc gaagcacgag      2340
     accgacaagg tgcgcgccga agggcccgcc tcgctcgcgc tcaagctgac cgtgccgcgc      2400
     acgccgaagc cgcatatcgg cgtggagggc gcggtcggct tccagaacaa ccgcctgagc      2460
     gtcgagaacg tgccaccgct gtcgcagttg aaaggcaagg tgcggtttac cgagcacacg      2520
     gcgcaggtgg accggctctc gggacaattc ctcggcggcg acgtgcatgc gaacggcggc      2580
     ctgaagcagg acggcaccta tgcgctcgac ctgggcggcc atatcgccgt cgacgcggcg      2640
     cgcggactcg atctgcacgg cccgggcgca caggtgctga cgcgcatgag cggcagcgcg      2700
     ccctacgcgc tcaacgtgcg cggcgcgaag ggacggctgc ccgaagtgac ggcgaattcc      2760
     gatctgaccg gccttgcgct cgacttcccc gcgccgttca acaagccggt cggcgcgccg      2820
     atgccgctgc gcttcgccgt cagcccgtcc gccgcgccgg gcgaagcggg actggagcgc      2880
     gccgacctca ccttcggccc gctcgccgcc gcctatctgc tgcgctacca gccgaaaacg      2940
     ccgccgaccg tggtgcgcgg cgcggtcggc gtgaaccggc ccgccgacct gccgtccgaa      3000
     ggcgtgatcg ccgccgtcga tctggacaca ttcgacgcgg acgcctggcg tgcgctggtc      3060
     acgcaaatac gcaccaaaga cgcgcccgct ccggcctccg tcacgccggc gccggccacg      3120
     ccgaatccaa ccgtcgcgca attcctgccg agccgcttcg cgctgcacgt cggcacgctg      3180
     acgctgctca agcgtcactg ggacagcgtg atcgtcggcg cctcgcacgc ggatcgcacg      3240
     tggcaggcga acatcgcgtc gaatcaggtg tccggccacg tgtcctggct gccgggcccg      3300
     accagggagt cgcccggcac gctgcaggcg cgctttgccc gcgtggtgat tccgtcggcc      3360
     accgacaagg acctgctcgg cgaggtcatg tcggcgccgg cgcagaacat gccgtccatc      3420
     gatctggtgg tcaacgaatt gatcgtgcgc gaccacaacg tcggccgtct cgaagtcgac      3480
     gcgcacaact tcgacgaaga cggcgtgccg gtctggcaac tcgacaagct cgacatcacc      3540
     aacccggcgg ctacgctcag cgcgaccgcg aactggcgca cctcgaccga cctcggcagc      3600
     agcgccgacg aagccacagc gcggcgcacc gtgttcgatt tcaagctcga catcaaggac      3660
     gccggcgcgc tgctcgaacg gttcggccag ccgcgcacgc tcaaggcggg cgctggctcg      3720
     ctgtcgggca agatggtgtg gcaaggcggc ccgacccgga tcgactaccc gacgctcaac      3780
     ggcaatctgg ccgtcgatct gcgccacggc cagatcctca aggtcgatcc gggcgtcgcc      3840
     aagctgctgg gcgtgctcag cctgcaaagc ctcgcgcgct tcgccacgct gaacttccgc      3900
     gacgtgatcg gcgaaggcct gccgttcgag cacgttaccg gcaccgcgca gattcacaac      3960
     ggcattggcc gcaccgagaa cttcgagatg gtcaccgcgc cggcgcgggc cgagatgaaa      4020
     ggctcggtgg atctcgccca ggagacccag gatctgcacg tccagatcgt gccgaccgtc      4080
     agcgccggcg ctgcggtgat cgccgccacg gtcatcaatc cgctgctcgg gctgggcgcg      4140
     ctggtggccg atctggcgtt cagccagtcg gtctcgcacg cgttcgcgcg ggagtatgcg      4200
     atcaccggct cgtggtcgaa accgcacgtc gagcgggtga agggcgatcg cggtaagatg      4260
     gacgctccgg cttcgaccgt ggaagcgcac tga                                   4293
//

If you have problems or comments...

PBIL Back to PBIL home page