(data stored in ACNUC7421 zone)

EMBL: CP000270.PE501

CP000270.PE501       Location/Qualifiers
FT   CDS_pept        567331..568473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3960"
FT                   /product="Putative DnaJ chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3960"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29039"
FT                   /db_xref="GOA:Q145F0"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q145F0"
FT                   /protein_id="ABE29039.1"
FT                   /translation="MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKHHPDRNPGNKDAEG
FT                   HFKEVKEAYEMLSDSQKRAAYDQYGHAGVDPNMGGAGAQGFGGFADAFGDIFGDIFGQA
FT                   AGGAARGGGGRAGPQVYRGADLRYSMEITLEQAAHGYDTQIRVPSWVSCEVCHGSGAKP
FT                   GTKPETCPTCSGSGSVRMSQGFFSIQQTCPKCHGTGTYIPDPCGHCHGAGKVKETKTLE
FT                   VKIPAGIDDGMRIRSAGNGEPGINGGPSGDLYVEIHIKQHSVFERDGDDLHCQMPIPFT
FT                   TAALGGEIEVPTLAGRASFTVPEGTQSGKTFRLRGKGIKGLRSSIAGDLYVHVQVETPV
FT                   KLTEPQRDLLKQFEKALVEGGSRHSPQSKSWFDRVKSFFD"
     atggcgaaac gggattacta cgaggttctg ggcgtcgcaa agaacgcgag cgacgacgaa        60
     atcaagaagg cttatcgcaa gctggcgatg aagcaccacc ctgaccgcaa tccgggcaac       120
     aaggatgcgg aagggcattt caaggaggtg aaggaagcct atgaaatgct ctcggactcg       180
     caaaagcgtg ccgcgtacga tcagtacggc cacgcgggtg tcgatccgaa catgggcggt       240
     gccggcgcac aaggttttgg tggttttgcc gatgcattcg gcgatatttt cggcgacatc       300
     ttcggccagg cggccggtgg cgccgcacgc ggcggtggcg gccgcgcggg cccgcaggtg       360
     tatcgcggcg ccgatctgcg ctacagcatg gaaatcacgc tggaacaggc cgcgcacggc       420
     tacgacacgc agattcgcgt gccgagctgg gtgtcgtgcg aggtctgcca cggttcgggc       480
     gccaagcccg gcaccaagcc ggaaacctgc ccgacctgta gcggttcggg ttcggtgcgg       540
     atgtcgcagg gtttcttcag catccagcaa acctgcccga agtgccacgg caccggcacc       600
     tacattcccg acccgtgcgg ccattgccac ggtgccggca aggtgaagga aaccaagacg       660
     ctggaagtga agatcccggc aggtatcgac gacggcatgc ggatccgttc ggccggcaac       720
     ggcgagccgg gtatcaacgg cgggccgtcg ggcgatctgt acgtcgagat tcacatcaag       780
     cagcattcgg tgttcgagcg cgacggcgac gatctgcact gccagatgcc gattccgttc       840
     accactgcgg cactgggcgg cgagatcgaa gtgccgacac tcgcgggccg cgccagcttt       900
     accgtgccgg aaggtacaca atcgggcaag acgttccgtc tgcgtggcaa gggcatcaag       960
     gggctgcgtt cgagtattgc cggcgatctg tacgtgcatg tgcaggtcga aacgccggtc      1020
     aagctcaccg agccgcagcg cgatctgctc aagcagttcg aaaaggcgct cgtcgagggc      1080
     ggctcgcggc atagtccgca aagcaaaagc tggttcgacc gggtgaagag cttcttcgat      1140
     taa                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page