(data stored in ACNUC7421 zone)

EMBL: CP000270.PE504

CP000270.PE504       Location/Qualifiers
FT   CDS_pept        complement(571617..572297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3957"
FT                   /product="Putative deoxynucleoside kinase"
FT                   /EC_number="2.7.1.113"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3957"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29042"
FT                   /db_xref="GOA:Q145E7"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:Q145E7"
FT                   /protein_id="ABE29042.1"
FT                   /translation="MNSSPLTVTAPQLRPPFGYLAIEGPIGVGKTSLARRLAQRWSMQE
FT                   MFERPQDNPFLERFYRDTVRYALPTQLHFALQRAQQAQDVSAAHLSGTPLIADFMTQKN
FT                   DIFARLTLQEDEWQLYRALAARLEVSAPAPDFVVYLQASPEVLFARIQKRAVPMELQIS
FT                   DAYLHALCDAYNEFFYHYDRTPVLTVNAEHLNPLDSDADLALLAERIETMRGRKEFFVK
FT                   GTSL"
     atgaattcat cgccgctcac cgtcacggcg ccgcagctgc ggccgccgtt cggctatctc        60
     gcgatcgaag gcccgatcgg cgtcggcaag acgtcgctcg cacggcgcct cgcgcagcgc       120
     tggtcgatgc aggaaatgtt cgaacggccg caagataatc cgtttctcga acgcttttac       180
     cgcgacaccg tgcgttacgc gttgcccacg caattgcact tcgccttgca acgcgcgcag       240
     caggctcagg acgtgagcgc ggcgcacctg tcgggcacgc cgctgatcgc cgatttcatg       300
     acgcagaaga acgacatctt cgcgcgtctg acgctacagg aagacgagtg gcagttgtat       360
     cgcgcgcttg ccgcgcggct cgaagtcagc gcgccggcgc cggacttcgt ggtctatctg       420
     caggcgagcc cggaggtgct gttcgcgcgc atccagaagc gcgcggtgcc gatggagcta       480
     cagatttccg acgcctatct gcacgccctg tgcgatgcgt acaacgaatt tttctatcac       540
     tacgaccgca cgcccgtgct gacggtcaac gccgaacacc tgaatccgct cgactcggac       600
     gcggaccttg cgctgcttgc cgaacgcatc gagaccatgc gcggccgcaa ggaattcttt       660
     gtcaaaggca cgtcgctctg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page