(data stored in ACNUC7421 zone)

EMBL: CP000270.PE509

CP000270.PE509       Location/Qualifiers
FT   CDS_pept        complement(576000..577151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3952"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3952"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29047"
FT                   /db_xref="GOA:Q145E2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q145E2"
FT                   /protein_id="ABE29047.1"
FT                   /translation="MRFYPMPAHWLEFESSGPDDTWETTLQENSSILTPVQRRAFTWLA
FT                   IALGIGILLWLLSPVLTPFLLGAILAYILQPGVAWMVRRRVPRGLAALVMMLFFTLLMT
FT                   LLVLLVLAVVQKEGPQLRQQVPVLFAHANAWLQPKLALLGLADSLDFASIRDMVMGQLE
FT                   GSAQTVALYAWTSIRTSGNVMITVVGNVVMVPLVLFYLLYDWNRMLARMQTVVPRRWLD
FT                   KTLQLAHDMDQMLSQYLRGQLLVMGVLAAYYAIALSLARFEIALPVGIFTGLAVFIPYI
FT                   GFATGLALALLAALLQFGDWYGFGAVALIYGVGQILESFFLTPRLVGERIGLHPLAVIF
FT                   ALLAFGQLFGFFGVLLALPVSAILSVATRELRQSYLASSLYKN"
     atgcgatttt acccgatgcc ggcccactgg ctggaatttg aatcatccgg tcccgacgac        60
     acctgggaaa caaccttgca agagaactcc tcgattctga cgccggtcca gcgccgcgcc       120
     ttcacctggc tggccattgc gctgggcatc ggcattctgc tctggctgct gagtccggtc       180
     ctcacgccgt ttctgctcgg tgcgattctc gcgtacattc tgcagccggg cgtcgcgtgg       240
     atggtgcgcc ggcgcgtgcc gcgcggtctg gcggcgttgg tgatgatgct gttcttcacg       300
     ttgctgatga cgctgctcgt cctgctggtg ctggccgtcg tgcagaaaga agggccgcaa       360
     ctgcggcagc aggtgcccgt gctgttcgcg catgcgaatg cgtggctgca acccaagctg       420
     gccttgctgg gactggccga ttcgctcgat ttcgccagca tccgcgatat ggtgatgggg       480
     cagctagaag gcagcgcgca gaccgtggca ctgtatgcat ggacctccat ccgcacgagc       540
     ggcaatgtga tgataacggt ggtcggcaac gtggtgatgg tgccgctcgt gctgttctac       600
     ctgctgtacg actggaaccg catgctcgcc cgcatgcaga ccgtggtgcc gcgccgctgg       660
     ctcgacaaga cgctgcaact cgcgcacgac atggaccaga tgctgtcgca atacctgcgc       720
     ggccagttgc tcgtgatggg cgtgctcgcc gcgtattacg ccatcgcgct gagcctcgcg       780
     cgcttcgaga tcgcgttgcc ggtcggcatt tttacggggc tcgcggtgtt catcccgtac       840
     atcggctttg cgaccggtct cgcgttggcg ctcctcgcgg cgctgctgca attcggcgac       900
     tggtacggct tcggcgcggt tgcgctgatc tacggcgtcg gccagatcct ggagagcttt       960
     tttctcacgc cgcgcctcgt gggcgaacgg atcggcctgc acccgctcgc ggtgattttc      1020
     gcgttgctcg cgttcgggca actgttcggc tttttcggcg ttttgctggc actgccggtc      1080
     agcgcgattc tgtcggtcgc cacgcgcgag ctgcggcaaa gctatctggc gagctcgctt      1140
     tataaaaact ga                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page