(data stored in ACNUC7421 zone)

EMBL: CP000270.PE51

CP000270.PE51        Location/Qualifiers
FT   CDS_pept        67290..67889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4411"
FT                   /product="Putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4411"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28589"
FT                   /db_xref="InterPro:IPR025500"
FT                   /db_xref="UniProtKB/TrEMBL:Q147A0"
FT                   /protein_id="ABE28589.1"
FT                   /translation="MTIKRFFPLRLAAVLWIALAVWLAAPGVAHADSIAVQRASLQADN
FT                   TGWNLDARFDFDLNSNLEDAVNKGIPLYFTTDFELSRPRWYWFDEQPVSVSQSIRLSFQ
FT                   PLTREYRVSSVSSGGLQLGFTTLKDALAVIKHITSWHVIDRNDVHAGENYTASVRMQLD
FT                   IALMPKPFQIDAVNNRDWNLASEWKRFTFTVTERAK"
     gtgaccatta aacgcttctt cccgcttcgg ctcgctgccg tgctctggat cgcgctggcc        60
     gtatggctgg cggcgccggg cgtggcgcat gctgactcga tcgcggtgca gcgtgcgtcg       120
     ctgcaagccg acaacaccgg ctggaacctc gacgcgcgtt tcgacttcga cctgaacagc       180
     aatctcgaag acgcggtcaa taaaggcatc ccgctctatt tcacgaccga cttcgaattg       240
     agccggccgc gctggtactg gttcgacgag cagccggtga gcgtgtcgca aagcatccgc       300
     ctgtcgttcc agccgcttac gcgtgagtac cgcgtgtcga gcgtgtcgtc cggcggtttg       360
     cagctcggct tcaccacgct caaggatgcg ctcgcggtca tcaagcacat cacgtcgtgg       420
     catgtgatag accgcaatga cgtgcacgcc ggggagaact acaccgcatc ggtgcgtatg       480
     cagctcgaca tcgcgctgat gcccaagccg tttcagatcg acgcggtgaa caaccgcgac       540
     tggaatctcg catccgaatg gaagcgcttt acctttacgg tgaccgaacg tgctaaataa       600
//

If you have problems or comments...

PBIL Back to PBIL home page