(data stored in ACNUC7421 zone)

EMBL: CP000270.PE510

CP000270.PE510       Location/Qualifiers
FT   CDS_pept        577235..578653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3951"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3951"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29048"
FT                   /db_xref="GOA:Q145E1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q145E1"
FT                   /protein_id="ABE29048.1"
FT                   /translation="MSTINTQHNPSFYSGKTATRSHYRLTTNRHGTYTLRLVVPKSLQS
FT                   LIQTKELKKSLRTRDFQKARMLAGHLSYQFDLMLATLMKKKLSDFNLDVINNIHKDLSV
FT                   TFNNVQYDFDINNEFERAEYLDLKARIEKHHADVGEVQKNVVVESSATQNSDKKYQSNF
FT                   KFVEVKDAFVKERMIKAGGKMTKSIDIYMASINEFWNKILSGTNPPITAINKLNARSFK
FT                   EHLIGTGITAQTVDNKVAHLQAFFTFIIKNYDYPFNNPFEGLKILNRAELKKVTNSFKP
FT                   FTMDELKIIFDVERYRAYYKKNIQLYFVPLIQLYSSMRVEEASQLHLDDIRQENGIYYF
FT                   NLNDDEDKSLKTINAFRNIPVHSKLIEIGLIKYYEERKKLGKRTLFDNQGEYVTTEFGA
FT                   YLKKLEIKKTARVHGTHSLRQNFNNALIDKDVISDVRCRLCGHELVGTNATVYGKDYKV
FT                   EELKRYIELVQFPI"
     atgtccacca tcaacaccca gcacaacccg tcattttaca gtggcaagac tgccacgcgc        60
     tcacactacc gccttactac caataggcat gggacataca cccttcgcct cgtggtccct       120
     aagtccctac aatcgcttat ccagaccaaa gaactgaaga aaagtctgcg tacaagggac       180
     tttcagaagg ccagaatgct agcagggcat ctgtcctatc agttcgacct catgcttgct       240
     actcttatga agaaaaagct atctgacttt aatcttgatg ttattaacaa cattcataaa       300
     gatttgagtg ttacgtttaa taacgttcaa tatgatttcg atataaataa cgaatttgag       360
     cgagccgagt acctcgacct taaggctcgc attgaaaagc atcacgctga tgtgggtgaa       420
     gtgcagaaga atgttgttgt tgagtcttcc gcaactcaaa attcggataa aaaatatcaa       480
     tcaaacttca aatttgttga agtcaaagat gcttttgtaa aagaaagaat gattaaagct       540
     ggtggaaaaa tgaccaaatc cattgatatt tatatggcaa gtatcaatga gttttggaat       600
     aaaattttaa gcgggaccaa tccacccatt acagctatta acaaattaaa cgcgcgctcg       660
     ttcaaagagc atctgattgg aactggaatc actgcccaaa ctgtggataa caaagttgct       720
     cacctacaag cttttttcac atttattatc aaaaattacg actatccttt taataaccca       780
     tttgaaggac tgaagatatt aaacagggct gaattgaaaa aagtcactaa ctcattcaag       840
     cccttcacaa tggatgagtt aaaaataatt tttgatgttg agcgctatag agcttattac       900
     aagaaaaata ttcaactcta ctttgtacca ctgatacagc tatatagcag tatgcgagtt       960
     gaagaagcca gccaactgca tttggatgac attaggcaag aaaatggcat ttattatttt      1020
     aatttaaacg acgatgaaga taagagccta aagacaatca atgccttcag gaacattccc      1080
     gtgcatagta aattgattga aattggtctc atcaaatact atgaagaaag aaaaaaatta      1140
     ggcaaaagga cgctttttga taatcaaggt gagtatgtca caactgaatt tggtgcatat      1200
     ctcaaaaagc ttgaaattaa aaaaacggct cgcgtgcatg gtacgcattc actcaggcaa      1260
     aacttcaata acgcactcat tgataaagat gtgatatctg atgtgcgttg taggctgtgc      1320
     ggtcatgaat tggtaggcac aaatgctaca gtttatggaa aagactacaa ggttgaagaa      1380
     ctgaagcgct acatagaact tgtgcaattt ccaatttaa                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page