(data stored in ACNUC7421 zone)

EMBL: CP000270.PE511

CP000270.PE511       Location/Qualifiers
FT   CDS_pept        578807..579451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3950"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29049"
FT                   /db_xref="UniProtKB/TrEMBL:Q145E0"
FT                   /protein_id="ABE29049.1"
FT                   /translation="MKNLLRYGCELIQEASDDESGINTNYKKLESLIKENPHLIASYDI
FT                   QTKNSLLFTAIQEESIEFVKLIKFYAEDKDLTAVVDNGSSPLSDVAMRNMIHNLDRFGQ
FT                   DAIETDNSLQIFKSVGELGGRLSKGLVLELEQDIAGANSLIKNAVEYDSVLKEKDALFS
FT                   KASTAKEKGFYNKLKQKIENFRVHLLALKDSADSDGPDALKNQKKGRKDKV"
     atgaaaaatt tactaaggta tggatgcgag ttgattcaag aggcaagtga cgatgagtct        60
     ggtattaaca ctaattacaa aaaactagaa agcttaatca aagaaaaccc acatcttatt       120
     gcttcatatg atatacaaac gaaaaattca ctattattta ctgcaattca agaagaatct       180
     atcgaatttg ttaaattaat taaattttac gcagaggata aagacctaac tgcggttgtt       240
     gacaatggct ccagcccgtt gtctgatgtg gcaatgagaa atatgattca taatttagat       300
     agatttgggc aagatgccat cgagacagat aactcattac aaatattcaa atctgtcggt       360
     gaattaggtg gccgtttgtc aaaaggtctg gtgttggagt tggagcaaga tatcgcaggt       420
     gctaatagtc taataaaaaa tgcagttgaa tacgattcag tgttaaaaga aaaagatgct       480
     ttatttagta aggcctctac tgctaaagaa aaaggttttt ataataagct aaagcaaaaa       540
     attgaaaatt tcagagttca tctactggct ttaaaagatt ctgctgatag tgatggtcct       600
     gatgccttaa aaaatcaaaa aaagggaagg aaagataagg tataa                       645
//

If you have problems or comments...

PBIL Back to PBIL home page