(data stored in ACNUC7421 zone)

EMBL: CP000270.PE519

CP000270.PE519       Location/Qualifiers
FT   CDS_pept        complement(586814..587203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3942"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3942"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29057"
FT                   /db_xref="UniProtKB/TrEMBL:Q145D2"
FT                   /protein_id="ABE29057.1"
FT                   /translation="MNNTDIKENKFLKSANFLGELKKIGLIEDFIFAGSFLSKIQNARV
FT                   ELSYDFLRMSLQNDMAEEYPDGHYMSTFEYYITDIDNFLMCMNDNFLGFVNDREIENYY
FT                   NVLLERYNLDQALEESTESLKPNKI"
     atgaacaata ccgatattaa agaaaacaaa tttttaaaat cggccaattt cctaggtgaa        60
     ctgaagaaaa ttggccttat tgaagatttt atttttgcag gctcctttct ttcaaaaata       120
     caaaacgccc gtgttgagtt gagttacgat ttccttagaa tgtcacttca aaatgatatg       180
     gctgaggaat atcctgatgg tcactacatg tcaacttttg agtattatat taccgatatt       240
     gataattttt taatgtgcat gaacgacaat tttttaggtt ttgtcaatga tcgcgagatt       300
     gaaaactact ataacgtttt actagaaaga tataatttgg atcaagcact tgaagaatcg       360
     accgaatcat tgaagccaaa caaaatttga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page