(data stored in ACNUC7421 zone)

EMBL: CP000270.PE52

CP000270.PE52        Location/Qualifiers
FT   CDS_pept        67891..70293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A4410"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A4410"
FT                   /db_xref="EnsemblGenomes-Tr:ABE28590"
FT                   /db_xref="GOA:Q146Z9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q146Z9"
FT                   /protein_id="ABE28590.1"
FT                   /translation="MRSATSVSSIVVRVLVSTVAVTAVLLLVLLAAASANTEFFDRYYQ
FT                   WLYAANLAVAMIFLLVVATLVIIIIARLRKGKFGTRLLAKLAFFMALVGVVPGGIIYVV
FT                   SYQFVSRSIESWFDVNVETALTSGLNLGRGMLDASLSDLQTKGRLMSEQLASADAAGTT
FT                   LTLLRLRDQFGVQDATIVEPTRSMSGATPDMHVVAQASGNYATLVPNDLPTPLMIDQAR
FT                   GRGYAAIEGEVDGDPHAHGSKGVLRLRVVQRIPDSNASLLQPTERFLQLTQPVSPSLAR
FT                   NADAVQRAYREYQEKALGRTGLRKMYIGTLTLALFLATFIAMMLALALGNQLARPLFLL
FT                   AQGTKEITEGDYTPKREIKSRDELGFLTQSFNAMTRQLSEARAAVENNRIALEHSKAYL
FT                   ESILANLTAGVFVFDRQFRLTTANRGAERIFRQPFQAVMGSALDQIGVLSEFGGMVRKA
FT                   FADREAASGDGHDDRGHWQQQFSVQVPGETEPLTLLVRGARLVSATDRDAEDMQTSGYV
FT                   VVFDDISDVISAQRSIAWGEVARRLAHEIKNPLTPIQLSAERLQMKLADKLSPSDADVL
FT                   KRGATTIVNQVAAMKQMVDNFRDYARTPPAVLAHLQLNDLVSEVLTLYGIEEGKGAIQV
FT                   ELAALPAIRGDATQLRQVIHNLLQNAQDAVADLEHPRVLLETRTVEYGDPDAEGKVRVA
FT                   VRLTVSDNGPGFSARILTRAFEPYVTTKAKGTGLGLAMVKKIVDEHGARIDIRNRMKAG
FT                   DVIEGAQISILFLQLADDAATPGTGPRPAHGGASQGKTKATVQTRAA"
     gtgcgctccg ccaccagtgt cagcagcatc gtcgtgcgcg tgctggtgtc cacggtcgcg        60
     gtcacggccg tgttgctgct cgtgctgctg gccgccgcca gcgcgaacac cgaattcttc       120
     gaccgctatt accagtggct ctatgcggcc aatctcgcgg tcgcgatgat ctttttgctg       180
     gtggtggcga cgctcgtcat catcatcatc gcgcggctga gaaagggtaa gttcggcacg       240
     cggctcctcg cgaaacttgc gttcttcatg gcgctggtcg gtgtcgtgcc gggcgggatc       300
     atctacgtcg tgtcatacca gttcgtgtcg cgcagcatcg agtcgtggtt cgacgtgaat       360
     gtcgaaaccg cgctcacgtc cggcctgaat ctcgggcgcg gcatgctcga cgcgtcgctg       420
     tccgatctgc agaccaaggg ccgtttgatg tccgagcagc tcgcgagcgc ggacgccgcc       480
     ggcaccacgc tcacgctgct gcgtctgcgc gatcagttcg gcgtgcagga tgcgacgatc       540
     gtcgaaccca cgcgcagcat gtcgggtgcg acgcccgata tgcacgtggt cgcgcaggca       600
     tccggcaact acgcgacgct cgtgccgaac gacctgccca cgccgctgat gatcgatcag       660
     gcgcgcggcc gcggctatgc ggcgatcgaa ggcgaagtgg acggcgatcc tcacgcgcat       720
     ggcagcaagg gcgtgctgcg tctgcgcgtg gtgcagcgca ttcccgactc gaacgcatcg       780
     ctgctgcagc ccaccgaacg cttcctgcaa ctcacgcagc cggtgtcgcc ctcgctcgcg       840
     cgcaacgccg atgcggtgca gcgcgcgtat cgcgagtacc aggagaaggc gctcggccgc       900
     acgggtctgc gcaagatgta cattggcacg ctgacgcttg cgctgttcct cgccaccttc       960
     atcgcgatga tgctggcgct cgcgctcggc aatcagctgg cgcggccgtt gttcctgctc      1020
     gcgcaaggca ccaaggaaat cacggaaggc gactacacgc cgaagcgcga aatcaaatcg      1080
     cgcgacgaac tgggctttct cacgcagtcg ttcaacgcga tgacacggca gttgtccgaa      1140
     gcgcgcgcgg ccgtcgagaa caaccgcatc gcgctcgaac attcgaaggc gtatctggaa      1200
     agcattctcg cgaacctgac cgcgggcgtg ttcgtattcg accggcagtt caggttgacc      1260
     acggcgaatc gcggcgccga acggattttc cgtcagccgt tccaggccgt gatgggttcg      1320
     gcgctggatc agatcggcgt gctgagcgaa ttcggcggca tggtccgcaa ggcttttgcc      1380
     gatcgcgaag cggcgagcgg cgatggtcac gacgatcgcg gccactggca gcagcagttt      1440
     tcggtgcagg tgccgggcga aaccgagccg ctcaccttgc tcgtgcgcgg cgcgcggctc      1500
     gtctcggcaa cggatcgcga tgcggaagac atgcagacgt ccggctacgt ggtggtgttc      1560
     gacgatattt cggacgtgat ctccgcgcag cgatcgatcg catggggcga ggtcgcgcgg      1620
     cggctcgcgc acgagatcaa gaatccgctc acgccgatcc agctttccgc cgagcgtttg      1680
     cagatgaagc tcgccgacaa gctgtcgcca tccgacgccg atgtgctgaa gcgcggcgcg      1740
     accacgatcg tcaaccaggt cgccgccatg aagcagatgg tcgataattt ccgcgactat      1800
     gcgcgcacgc cgccggcggt gctcgcgcat ctgcaactga atgatctggt cagcgaagtg      1860
     ctcacgctgt acggtatcga agaaggcaaa ggcgcgatcc aggtcgagct cgctgcgttg      1920
     ccggccattc gcggcgacgc gacgcaattg cgtcaggtga ttcacaacct gctgcagaac      1980
     gcgcaggatg cggtagcgga cctcgagcat ccgcgtgtgt tgctcgagac gaggacagta      2040
     gaatacggag accccgacgc ggaaggcaaa gtacgcgtcg cggtgcgtct gacggtgtcg      2100
     gacaacgggc cgggcttctc cgcgcgtatc ctcactcgtg cattcgaacc ttacgtgacg      2160
     accaaggcca aaggtacggg cctgggtctt gcgatggtca agaagatcgt cgacgaacac      2220
     ggcgcgcgca tcgacatccg caatcgtatg aaagcgggcg atgtcatcga gggcgcgcag      2280
     atctcgatcc tcttccttca actggcagac gatgccgcga cacctggaac agggccgcgt      2340
     ccggcgcacg gcggtgcgtc gcagggaaag acaaaagcaa cagtgcagac aagggcagcg      2400
     taa                                                                    2403
//

If you have problems or comments...

PBIL Back to PBIL home page