(data stored in ACNUC7421 zone)

EMBL: CP000270.PE520

CP000270.PE520       Location/Qualifiers
FT   CDS_pept        587322..587639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3941"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3941"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29058"
FT                   /db_xref="UniProtKB/TrEMBL:Q145D1"
FT                   /protein_id="ABE29058.1"
FT                   /translation="MSDDFHVENGRKGGEARAKKFWPKIKHSIILFIRFPELNQDEIAK
FT                   RVGASQAFVSKHTSYNALKIARLSAQSDSMSEDELEALLEKIKLEVELKNEIVKPKRSK
FT                   L"
     atgtcagatg attttcatgt ggaaaatggg cgaaaaggtg gggaagctag ggcaaaaaaa        60
     ttctggccaa agataaaaca ttcaattatt ttatttattc gatttcctga actaaatcaa       120
     gatgagattg caaaacgtgt aggtgcttca caagcgtttg ttagtaagca tactagctac       180
     aacgcgctaa aaattgctcg tttgtctgct caaagtgatt caatgagtga agatgagctt       240
     gaggcgttgc ttgaaaaaat taagctagaa gttgagctaa aaaatgaaat tgtgaagcct       300
     aaacgcagta agttatga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page