(data stored in ACNUC7421 zone)

EMBL: CP000270.PE521

CP000270.PE521       Location/Qualifiers
FT   CDS_pept        complement(587841..588134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_A3940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_A3940"
FT                   /db_xref="EnsemblGenomes-Tr:ABE29059"
FT                   /db_xref="UniProtKB/TrEMBL:Q145D0"
FT                   /protein_id="ABE29059.1"
FT                   /translation="MSLNCDIFDAYKSIIPKNMNPTTFTAELVRQFLAENFSKITHKPT
FT                   LVSREDFDDFIHGIVTHSELNELAKAHELRKQIDTTKEKLALLKKHETVGQA"
     ttgagtttaa attgtgatat ttttgatgcc tataaatcaa ttattccaaa aaatatgaac        60
     ccaactactt tcactgcgga gcttgttcga caatttttag ctgaaaattt ttcaaaaatt       120
     acacacaaac caactttagt tagtcgagaa gattttgatg atttcataca tggtatcgtc       180
     actcattctg aactaaatga attggcaaaa gctcatgaac ttagaaagca aatagataca       240
     actaaagaaa agttggctct tttgaagaaa catgaaacag taggtcaagc atga             294
//

If you have problems or comments...

PBIL Back to PBIL home page